Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10129)
Regulator Name RNA-binding motif, single-stranded-interacting protein 1 (RBMS1)
Synonyms
C2orf12, MSSP, MSSP1, SCR2; Single-stranded DNA-binding protein MSSP-1; Suppressor of CDC2 with RNA-binding motif 2
    Click to Show/Hide
Gene Name RBMS1
Gene ID 5937
Regulator Type Protein coding
Uniprot ID P29558
Sequence
MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLS
KTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV
SALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS
RGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPN
GRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYIASPVSAYQ
VQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATS
AMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK

    Click to Show/Hide
Function
Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.

    Click to Show/Hide
HGNC ID
HGNC:9907
KEGG ID hsa:5937
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
RBMS1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Responsed Drug Nortriptyline hydrochloride Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
Doxorubicin (Dox)- inducible RBMS1 knockdown stable cells (3 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice (Vital River). Mice were fed either with sucrose water or sucrose water containing 0.1% doxycycline hyclate. H1299 vector, 4 H1299 pLKO.1 RBMS1 and H1299 pLKO.1 RBMS1/SLC7A11 cells (2.5 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice(Vital River). The xenograft tumour formation was monitored using callipers every 3 days.

    Click to Show/Hide
Response regulation RBMS1 ablation inhibited the translation of SLC7A11, reduced SLC7A11-mediated cystine uptake, and promoted ferroptosis. Nortriptyline hydrochloride decreased the level of RBMS1, thereby promoting ferroptosis. Importantly, RBMS1 depletion or inhibition by nortriptyline hydrochloride sensitized radioresistant lung cancer cells to radiotherapy.
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Target for Ferroptosis Suppressor
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Ferroptosis hsa04216
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
C57BL/6 mice (4- to 6-week-old male) were fed in a pathogen-free vivarium under standard conditions at the animal care facility at Sun Yat-sen University. Hepa 1-6 cells transduced with RBMS1 or GPX4 or circIDE overexpression lentiviral vectors were subcutaneously injected into the right flank of mice in 100 ul of sterile PBS. IVIS images were taken.

    Click to Show/Hide
Response regulation RBMS1 overexpression inhibited hepatocellular Carcinoma (HCC) cell growth by attenuating the expression of glutathione peroxidase 4 (GPX4)and further facilitated ferroptosis in vitro and in vivo. More importantly, a novel circIDE (hsa_circ_0000251) was identified to elevate RBMS1 expression via sponging miR-19b-3p in HCC cells.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator RNA-binding motif, single-stranded-interacting protein 1 (RBMS1) Protein coding
 Regulator Info 
Responsed Drug Nortriptyline hydrochloride Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
Doxorubicin (Dox)- inducible RBMS1 knockdown stable cells (3 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice (Vital River). Mice were fed either with sucrose water or sucrose water containing 0.1% doxycycline hyclate. H1299 vector, 4 H1299 pLKO.1 RBMS1 and H1299 pLKO.1 RBMS1/SLC7A11 cells (2.5 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice(Vital River). The xenograft tumour formation was monitored using callipers every 3 days.

    Click to Show/Hide
Response regulation RBMS1 ablation inhibited the translation of SLC7A11, reduced SLC7A11-mediated cystine uptake, and promoted ferroptosis. Nortriptyline hydrochloride decreased the level of RBMS1, thereby promoting ferroptosis. Importantly, RBMS1 depletion or inhibition by nortriptyline hydrochloride sensitized radioresistant lung cancer cells to radiotherapy.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator RNA-binding motif, single-stranded-interacting protein 1 (RBMS1) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
C57BL/6 mice (4- to 6-week-old male) were fed in a pathogen-free vivarium under standard conditions at the animal care facility at Sun Yat-sen University. Hepa 1-6 cells transduced with RBMS1 or GPX4 or circIDE overexpression lentiviral vectors were subcutaneously injected into the right flank of mice in 100 ul of sterile PBS. IVIS images were taken.

    Click to Show/Hide
Response regulation RBMS1 overexpression inhibited hepatocellular Carcinoma (HCC) cell growth by attenuating the expression of glutathione peroxidase 4 (GPX4)and further facilitated ferroptosis in vitro and in vivo. More importantly, a novel circIDE (hsa_circ_0000251) was identified to elevate RBMS1 expression via sponging miR-19b-3p in HCC cells.
Nortriptyline hydrochloride [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Cystine/glutamate transporter (SLC7A11) Driver; Suppressor
 Target Info 
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
Doxorubicin (Dox)- inducible RBMS1 knockdown stable cells (3 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice (Vital River). Mice were fed either with sucrose water or sucrose water containing 0.1% doxycycline hyclate. H1299 vector, 4 H1299 pLKO.1 RBMS1 and H1299 pLKO.1 RBMS1/SLC7A11 cells (2.5 x 106 ) were injected subcutaneously into the abdomen side of 6-week-old BALB/c nude mice(Vital River). The xenograft tumour formation was monitored using callipers every 3 days.

    Click to Show/Hide
Response regulation RBMS1 ablation inhibited the translation of SLC7A11, reduced SLC7A11-mediated cystine uptake, and promoted ferroptosis. Nortriptyline hydrochloride decreased the level of RBMS1, thereby promoting ferroptosis. Importantly, RBMS1 depletion or inhibition by nortriptyline hydrochloride sensitized radioresistant lung cancer cells to radiotherapy.
References
Ref 1 RBMS1 regulates lung cancer ferroptosis through translational control of SLC7A11. J Clin Invest. 2021 Nov 15;131(22):e152067. doi: 10.1172/JCI152067.
Ref 2 Suppressing circIDE/miR-19b-3p/RBMS1 axis exhibits promoting-tumour activity through upregulating GPX4 to diminish ferroptosis in hepatocellular carcinoma. Epigenetics. 2023 Dec;18(1):2192438. doi: 10.1080/15592294.2023.2192438.