Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10048)
Regulator Name Mitofusin-2 (MFN2)
Synonyms
Transmembrane GTPase MFN2
    Click to Show/Hide
Gene Name MFN2
Gene ID 9927
Regulator Type Protein coding
Uniprot ID O95140
Sequence
MSLLFSRCNSIVTVKKNKRHMAEVNASPLKHFVTAKKKINGIFEQLGAYIQESATFLEDT
YRNAELDPVTTEEQVLDVKGYLSKVRGISEVLARRHMKVAFFGRTSNGKSTVINAMLWDK
VLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKTVNQLAHALHQDKQLHAGSLVS
VMWPNSKCPLLKDDLVLMDSPGIDVTTELDSWIDKFCLDADVFVLVANSESTLMQTEKHF
FHKVSERLSRPNIFILNNRWDASASEPEYMEEVRRQHMERCTSFLVDELGVVDRSQAGDR
IFFVSAKEVLNARIQKAQGMPEGGGALAEGFQVRMFEFQNFERRFEECISQSAVKTKFEQ
HTVRAKQIAEAVRLIMDSLHMAAREQQVYCEEMREERQDRLKFIDKQLELLAQDYKLRIK
QITEEVERQVSTAMAEEIRRLSVLVDDYQMDFHPSPVVLKVYKNELHRHIEEGLGRNMSD
RCSTAITNSLQTMQQDMIDGLKPLLPVSVRSQIDMLVPRQCFSLNYDLNCDKLCADFQED
IEFHFSLGWTMLVNRFLGPKNSRRALMGYNDQVQRPIPLTPANPSMPPLPQGSLTQEEFM
VSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLYVYERLTWTTKAKERA
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGTFAHLCQQVDVTRENLEQEIAAMNKK
IEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR

    Click to Show/Hide
Family Dynamin/Fzo/YdjA family
Function
Mitochondrial outer membrane GTPase that mediates mitochondrial clustering and fusion. Mitochondria are highly dynamic organelles, and their morphology is determined by the equilibrium between mitochondrial fusion and fission events. Overexpression induces the formation of mitochondrial networks. Membrane clustering requires GTPase activity and may involve a major rearrangement of the coiled coil domains (Probable). Plays a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. Plays an important role in the regulation of vascular smooth muscle cell proliferation. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). Is required for PRKN recruitment to dysfunctional mitochondria. Involved in the control of unfolded protein response (UPR) upon ER stress including activation of apoptosis and autophagy during ER stress. Acts as an upstream regulator of EIF2AK3 and suppresses EIF2AK3 activation under basal conditions.

    Click to Show/Hide
HGNC ID
HGNC:16877
KEGG ID hsa:9927
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MFN2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Long-chain-fatty-acid--CoA ligase 4 (ACSL4) [Driver]
 Target Info 
In total 2 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Nonalcoholic fatty liver disease ICD-11: DB92
 Disease Info 
Responsed Drug Arsenic Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Nonalcoholic fatty liver disease ICD-11: DB92
 Disease Info 
Responsed Drug Sodium arsenite Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
Nonalcoholic fatty liver disease [ICD-11: DB92]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Mitofusin-2 (MFN2) Protein coding
 Regulator Info 
Responsed Drug Arsenic Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Mitofusin-2 (MFN2) Protein coding
 Regulator Info 
Responsed Drug Sodium arsenite Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
Arsenic [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Long-chain-fatty-acid--CoA ligase 4 (ACSL4) Driver
 Target Info 
Responsed Disease Nonalcoholic fatty liver disease ICD-11: DB92
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
Sodium arsenite [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Long-chain-fatty-acid--CoA ligase 4 (ACSL4) Driver
 Target Info 
Responsed Disease Nonalcoholic fatty liver disease ICD-11: DB92
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Adult male Sprague-Dawley rats (300 g-350 g, specific pathogen free) were obtained from Institute of Genome Engineered Animal Models for Human Disease of Dalian Medical University (Dalian, China). To explore the influence of NaAsO2 (CAS No.7784-46-5, Sigma-Aldrich, USA) on the liver, the rats were subjected to NaAsO2 at the dosage of 0, 2.5, and 5 mg/kg by gavage for 9 months. The control group was gavaged with distilled water as vehicle.

    Click to Show/Hide
Response regulation Arsenic induces rat liver nonalcoholic steatohepatitis (NASH) and Ferroptosis via interacting between Mitofusin-2 with IRE1. NaAsO2 increases IRE1 and Mfn2 expression, subsequently led to upregulated ACSL4 expression and 5-HETE via the directly combination Mfn2 with IRE1, ultimately induced ferroptotic cell death.
References
Ref 1 Ferroptosis mediated by the interaction between Mfn2 and IRE promotes arsenic-induced nonalcoholic steatohepatitis. Environ Res. 2020 Sep;188:109824. doi: 10.1016/j.envres.2020.109824. Epub 2020 Jun 23.