Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10466)
Regulator Name Epithelial membrane protein 1 (EMP1)
Synonyms
B4B; TMP; CL-20; Protein B4B; Tumor-associated membrane protein
    Click to Show/Hide
Gene Name EMP1
Gene ID 2012
Regulator Type Protein coding
Uniprot ID P54849
Sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA
LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY
ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK

    Click to Show/Hide
Family PMP-22/EMP/MP20 family
HGNC ID
HGNC:3333
KEGG ID hsa:2012
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
EMP1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
NADPH oxidase 4 (NOX4) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
In Vitro Model
 RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
HEK-293T cells Normal Homo sapiens CVCL_0063
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
In Vivo Model
One million 786O cells with or without shTAZ were implanted subcutaneously into the healthy 8-week-old JAX NOD.CB17-PrkdcSCID-J mice; both male and female mice were used. Once tumor volume reached 120 mm3, mice were randomized into control or erastin treatment group. The vehicle (ORA-plus) or erastin (0.1 ml of 4 mg/ml erastin) was administrated by oral gavage twice daily for 20 days.

    Click to Show/Hide
Response regulation Cell density-regulated ferroptosis is mediated by TAZ through the regulation of EMP1-NOX4, suggesting its therapeutic potential for renal cell carcinoma (RCC) and other TAZ-activated tumors.
Hereditary Leiomyomatosis [ICD-11: 2C90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Epithelial membrane protein 1 (EMP1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
In Vitro Model
 RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
HEK-293T cells Normal Homo sapiens CVCL_0063
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
In Vivo Model
One million 786O cells with or without shTAZ were implanted subcutaneously into the healthy 8-week-old JAX NOD.CB17-PrkdcSCID-J mice; both male and female mice were used. Once tumor volume reached 120 mm3, mice were randomized into control or erastin treatment group. The vehicle (ORA-plus) or erastin (0.1 ml of 4 mg/ml erastin) was administrated by oral gavage twice daily for 20 days.

    Click to Show/Hide
Response regulation Cell density-regulated ferroptosis is mediated by TAZ through the regulation of EMP1-NOX4, suggesting its therapeutic potential for renal cell carcinoma (RCC) and other TAZ-activated tumors.
References
Ref 1 The Hippo Pathway Effector TAZ Regulates Ferroptosis in Renal Cell Carcinoma. Cell Rep. 2019 Sep 3;28(10):2501-2508.e4. doi: 10.1016/j.celrep.2019.07.107.