Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10431)
Regulator Name MIT domain-containing protein 1 (MITD1)
Gene Name MITD1
Gene ID 129531
Regulator Type Protein coding
Uniprot ID Q8WV92
Sequence
MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCN
LREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWI
EDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSH
GVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDI
FHKKHTKNI

    Click to Show/Hide
Function
Required for efficient abscission at the end of cytokinesis, together with components of the ESCRT-III complex.

    Click to Show/Hide
HGNC ID
HGNC:25207
KEGG ID hsa:129531
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MITD1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
A-498 cells Renal cell carcinoma Homo sapiens CVCL_1056
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Response regulation MITD1 knockdown inhibited clear cell renal cell carcinoma (ccRCC) cell proliferation and migration and induced ferroptosis in ccRCC. Subsequent overexpression experiments demonstrated that MITD1 knockdown induced ferroptosis and suppressed tumor growth and migration through the TAZ/SLC7A11 pathway.
Hereditary Leiomyomatosis [ICD-11: 2C90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator MIT domain-containing protein 1 (MITD1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
A-498 cells Renal cell carcinoma Homo sapiens CVCL_1056
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Response regulation MITD1 knockdown inhibited clear cell renal cell carcinoma (ccRCC) cell proliferation and migration and induced ferroptosis in ccRCC. Subsequent overexpression experiments demonstrated that MITD1 knockdown induced ferroptosis and suppressed tumor growth and migration through the TAZ/SLC7A11 pathway.
References
Ref 1 MITD1 Deficiency Suppresses Clear Cell Renal Cell Carcinoma Growth and Migration by Inducing Ferroptosis through the TAZ/SLC7A11 Pathway. Oxid Med Cell Longev. 2022 Aug 22;2022:7560569. doi: 10.1155/2022/7560569. eCollection 2022.