Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10387)
Regulator Name Transcription factor E2F7 (E2F7)
Gene Name E2F7
Gene ID 144455
Regulator Type Protein coding
Uniprot ID Q96AV8
Sequence
MEVNCLTLKDLISPRQPRLDFAVEDGENAQKENIFVDRSRMAPKTPIKNEPIDLSKQKKF
TPERNPITPVKFVDRQQAEPWTPTANLKMLISAASPDIRDREKKKGLFRPIENKDDAFTD
SLQLDVVGDSAVDEFEKQRPSRKQKSLGLLCQKFLARYPSYPLSTEKTTISLDEVAVSLG
VERRRIYDIVNVLESLHLVSRVAKNQYGWHGRHSLPKTLRNLQRLGEEQKYEEQMAYLQQ
KELDLIDYKFGERKKDGDPDSQEQQLLDFSEPDCPSSSANSRKDKSLRIMSQKFVMLFLV
SKTKIVTLDVAAKILIEESQDAPDHSKFKTKVRRLYDIANVLTSLALIKKVHVTEERGRK
PAFKWIGPVDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERI
QRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPV
APFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPAL
LAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEER
KPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLP
AAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPAGLNGFNV
LLSGSQTPPTVGPSSGQLPSFSVPCMVLPSPPLGPFPVLYSPAMPGPVSSTLGALPNTGP
VNFSLPGLGSIAQLLVGPTAVVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPES
PVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQ
RRLEIPSGGAD

    Click to Show/Hide
Family E2F/DP family
Function
Atypical E2F transcription factor that participates in various processes such as angiogenesis, polyploidization of specialized cells and DNA damage response. Mainly acts as a transcription repressor that binds DNA independently of DP proteins and specifically recognizes the E2 recognition site 5'-TTTC[CG]CGC-3'. Directly represses transcription of classical E2F transcription factors such as E2F1. Acts as a regulator of S-phase by recognizing and binding the E2-related site 5'-TTCCCGCC-3' and mediating repression of G1/S-regulated genes. Plays a key role in polyploidization of cells in placenta and liver by regulating the endocycle, probably by repressing genes promoting cytokinesis and antagonizing action of classical E2F proteins (E2F1, E2F2 and/or E2F3). Required for placental development by promoting polyploidization of trophoblast giant cells. Also involved in DNA damage response: up-regulated by p53/TP53 following genotoxic stress and acts as a downstream effector of p53/TP53-dependent repression by mediating repression of indirect p53/TP53 target genes involved in DNA replication. Acts as a promoter of sprouting angiogenesis, possibly by acting as a transcription activator: associates with HIF1A, recognizes and binds the VEGFA promoter, which is different from canonical E2 recognition site, and activates expression of the VEGFA gene. Acts as a negative regulator of keratinocyte differentiation. { | , | , | , | , | , | , | , | }.

    Click to Show/Hide
HGNC ID
HGNC:23820
KEGG ID hsa:144455
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
E2F7 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Responsed Drug Dexmedetomidine Approved
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SNU-1 cells Gastric adenocarcinoma Homo sapiens CVCL_0099
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
GES-1 cells Normal Homo sapiens CVCL_EQ22
In Vivo Model
Female BALB/c nude mice (4-6 weeks old) were obtained from Beijing Institute of Life Sciences (Beijing, China) and the mice were maintained under the standard conditions. AGS cells (2 x 106 cells/mL) were suspended in 100 ul of PBS and were subcutaneously injected in the right flank of mice. After 1 week, mice were divided into four groups (n = 5): Ctrl, 0.5 ug/kg, 1.0 ug/kg, and 2.0 ug/kg groups. The mice were intraperitoneally injected with DEX once a day for 15 days. Mice in the control group were injected with the same amount of normal saline. Tumor size was measured every 2 days and calculated with the formula: 0.5 x length x width2. After the last DEX injection was completed, mice were euthanized with sodium pentobarbital (100 mg/kg) and then sacrificed by decapitation. The tumor tissues were isolated and weighted. Immunohistochemistry for Ki67 and TUNEL assay were performed on paraffin-embedded xenograft tumor tissue sections.

    Click to Show/Hide
Response regulation The current work studied the role of Dexmedetomidine (DEX) in gastric cancer cells and discovered that DEX suppressed GC growth by causing ferroptosis. Furthermore, the circ0008035/miR-302a/E2F7 axis was involved in DEX-induced ferroptotic cell death in GC.
Gastric cancer [ICD-11: 2B72]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transcription factor E2F7 (E2F7) Protein coding
 Regulator Info 
Responsed Drug Dexmedetomidine Approved
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SNU-1 cells Gastric adenocarcinoma Homo sapiens CVCL_0099
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
GES-1 cells Normal Homo sapiens CVCL_EQ22
In Vivo Model
Female BALB/c nude mice (4-6 weeks old) were obtained from Beijing Institute of Life Sciences (Beijing, China) and the mice were maintained under the standard conditions. AGS cells (2 x 106 cells/mL) were suspended in 100 ul of PBS and were subcutaneously injected in the right flank of mice. After 1 week, mice were divided into four groups (n = 5): Ctrl, 0.5 ug/kg, 1.0 ug/kg, and 2.0 ug/kg groups. The mice were intraperitoneally injected with DEX once a day for 15 days. Mice in the control group were injected with the same amount of normal saline. Tumor size was measured every 2 days and calculated with the formula: 0.5 x length x width2. After the last DEX injection was completed, mice were euthanized with sodium pentobarbital (100 mg/kg) and then sacrificed by decapitation. The tumor tissues were isolated and weighted. Immunohistochemistry for Ki67 and TUNEL assay were performed on paraffin-embedded xenograft tumor tissue sections.

    Click to Show/Hide
Response regulation The current work studied the role of Dexmedetomidine (DEX) in gastric cancer cells and discovered that DEX suppressed GC growth by causing ferroptosis. Furthermore, the circ0008035/miR-302a/E2F7 axis was involved in DEX-induced ferroptotic cell death in GC.
Dexmedetomidine [Approved]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 SNU-1 cells Gastric adenocarcinoma Homo sapiens CVCL_0099
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
GES-1 cells Normal Homo sapiens CVCL_EQ22
In Vivo Model
Female BALB/c nude mice (4-6 weeks old) were obtained from Beijing Institute of Life Sciences (Beijing, China) and the mice were maintained under the standard conditions. AGS cells (2 x 106 cells/mL) were suspended in 100 ul of PBS and were subcutaneously injected in the right flank of mice. After 1 week, mice were divided into four groups (n = 5): Ctrl, 0.5 ug/kg, 1.0 ug/kg, and 2.0 ug/kg groups. The mice were intraperitoneally injected with DEX once a day for 15 days. Mice in the control group were injected with the same amount of normal saline. Tumor size was measured every 2 days and calculated with the formula: 0.5 x length x width2. After the last DEX injection was completed, mice were euthanized with sodium pentobarbital (100 mg/kg) and then sacrificed by decapitation. The tumor tissues were isolated and weighted. Immunohistochemistry for Ki67 and TUNEL assay were performed on paraffin-embedded xenograft tumor tissue sections.

    Click to Show/Hide
Response regulation The current work studied the role of Dexmedetomidine (DEX) in gastric cancer cells and discovered that DEX suppressed GC growth by causing ferroptosis. Furthermore, the circ0008035/miR-302a/E2F7 axis was involved in DEX-induced ferroptotic cell death in GC.
References
Ref 1 Dexmedetomidine promotes ferroptotic cell death in gastric cancer via hsa_circ_0008035/miR-302a/E2F7 axis. Kaohsiung J Med Sci. 2023 Apr;39(4):390-403. doi: 10.1002/kjm2.12650. Epub 2023 Jan 31.