General Information of the Ferroptosis Regulator (ID: REG10376)
Regulator Name Krueppel-like factor 2 (KLF2)
Synonyms
LKLF; Lung krueppel-like factor
    Click to Show/Hide
Gene Name KLF2
Gene ID 10365
Regulator Type Protein coding
Uniprot ID Q9Y5W3
Sequence
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM

    Click to Show/Hide
Family Krueppel C2H2-type zinc-finger protein family
Function
Transcription factor that binds to the CACCC box in the promoter of target genes such as HBB/beta globin or NOV and activates their transcription. Might be involved in transcriptional regulation by modulating the binding of the RARA nuclear receptor to RARE DNA elements.

    Click to Show/Hide
HGNC ID
HGNC:6347
KEGG ID hsa:10365
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
KLF2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
HEK-293T cells Normal Homo sapiens CVCL_0063
HK-2 cells Normal Homo sapiens CVCL_0302
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
In Vivo Model
BALB/c mice were purchased from the Animal Core Facility of Nanjing Medical University. Injection into the tail vein of 6-week-old male mice with Renca-luci (luciferase) cells (1 x 105 cells) was adopted to build the model oflung metastasis. Before lungs were harvested after 1 month to assess pulmonary metastasis, lung metastatic nodules were tracked with IVIS spectrum imaging system in vivo or not (n = 5/group). For survival analysis, the time of death was recorded in each group (n = 10/group) after cells were injected. For assessing the effect of liproxstatin-1 (Lipro, Sigma), one week after injection of cells in the tail vein, mice were tail intravenous administrated with 2.5 mg/kg Lipro three times on a weekly basis for two weeks, then lungs were harvested ( n= 5/group).

    Click to Show/Hide
Response regulation Analysis of clinical specimens revealed that there is a close correlation between KLF2 and GPX4 in clear cell renal cell carcinoma (ccRCC). Mechanistically, KLF2 deficiency is sufficient to inhibit ferroptosis on account of the impairment of transcriptional repression of GPX4 and thus promotes the migration and invasion of RCC cells.
Hereditary Leiomyomatosis [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Krueppel-like factor 2 (KLF2) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
HEK-293T cells Normal Homo sapiens CVCL_0063
HK-2 cells Normal Homo sapiens CVCL_0302
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
In Vivo Model
BALB/c mice were purchased from the Animal Core Facility of Nanjing Medical University. Injection into the tail vein of 6-week-old male mice with Renca-luci (luciferase) cells (1 x 105 cells) was adopted to build the model oflung metastasis. Before lungs were harvested after 1 month to assess pulmonary metastasis, lung metastatic nodules were tracked with IVIS spectrum imaging system in vivo or not (n = 5/group). For survival analysis, the time of death was recorded in each group (n = 10/group) after cells were injected. For assessing the effect of liproxstatin-1 (Lipro, Sigma), one week after injection of cells in the tail vein, mice were tail intravenous administrated with 2.5 mg/kg Lipro three times on a weekly basis for two weeks, then lungs were harvested ( n= 5/group).

    Click to Show/Hide
Response regulation Analysis of clinical specimens revealed that there is a close correlation between KLF2 and GPX4 in clear cell renal cell carcinoma (ccRCC). Mechanistically, KLF2 deficiency is sufficient to inhibit ferroptosis on account of the impairment of transcriptional repression of GPX4 and thus promotes the migration and invasion of RCC cells.
References
Ref 1 KLF2 inhibits cancer cell migration and invasion by regulating ferroptosis through GPX4 in clear cell renal cell carcinoma. Cancer Lett. 2021 Dec 1;522:1-13. doi: 10.1016/j.canlet.2021.09.014. Epub 2021 Sep 11.