Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10332)
Regulator Name WW domain-containing transcription regulator protein 1 (WWTR1)
Synonyms
TAZ; Transcriptional coactivator with PDZ-binding motif
    Click to Show/Hide
Gene Name WWTR1
Gene ID 25937
Regulator Type Protein coding
Uniprot ID Q9GZV5
Sequence
MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGS
HSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDV
TDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQR
SMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRI
QMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL
NGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDF
LDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL

    Click to Show/Hide
Function
Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. In conjunction with YAP1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. Plays a key role in coupling SMADs to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self- renewal, promotes cell proliferation and epithelial-mesenchymal transition.

    Click to Show/Hide
HGNC ID
HGNC:24042
KEGG ID hsa:25937
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
WWTR1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Cytochrome b-245 heavy chain (CYBB) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Ovarian cancer ICD-11: 2C73
 Disease Info 
Responsed Drug Carboplatin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
In Vitro Model
 Caov-2 cells Ovarian carcinoma Homo sapiens CVCL_6861
TOV-21G cells Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3613
Response regulation There is a significant correlation between the expression of ANGPTL4 and TAZ (encoded by WWTR1) in the TCGA ovarian tumor dataset. Carboplatin-treated CAOV2R cells are less sensitive to ferroptosis and have a lower level of TAZ (TAFAZZIN). TAZ promotes ferroptosis in ovarian cancers by regulating ANGPTL4 and NOX2, offering a novel therapeutic potential for ovarian tumors with TAZ activation.
Ovarian cancer [ICD-11: 2C73]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator WW domain-containing transcription regulator protein 1 (WWTR1) Protein coding
 Regulator Info 
Responsed Drug Carboplatin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
In Vitro Model
 Caov-2 cells Ovarian carcinoma Homo sapiens CVCL_6861
TOV-21G cells Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3613
Response regulation There is a significant correlation between the expression of ANGPTL4 and TAZ (encoded by WWTR1) in the TCGA ovarian tumor dataset. Carboplatin-treated CAOV2R cells are less sensitive to ferroptosis and have a lower level of TAZ (TAFAZZIN). TAZ promotes ferroptosis in ovarian cancers by regulating ANGPTL4 and NOX2, offering a novel therapeutic potential for ovarian tumors with TAZ activation.
Carboplatin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Suppressor
Response Target Cytochrome b-245 heavy chain (CYBB) Driver
 Target Info 
Responsed Disease Ovarian cancer ICD-11: 2C73
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Hippo signaling pathway hsa04390
Cell Process Cell ferroptosis
In Vitro Model
 Caov-2 cells Ovarian carcinoma Homo sapiens CVCL_6861
TOV-21G cells Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3613
Response regulation There is a significant correlation between the expression of ANGPTL4 and TAZ (encoded by WWTR1) in the TCGA ovarian tumor dataset. Carboplatin-treated CAOV2R cells are less sensitive to ferroptosis and have a lower level of TAZ (TAFAZZIN). TAZ promotes ferroptosis in ovarian cancers by regulating ANGPTL4 and NOX2, offering a novel therapeutic potential for ovarian tumors with TAZ activation.
References
Ref 1 A TAZ-ANGPTL4-NOX2 Axis Regulates Ferroptotic Cell Death and Chemoresistance in Epithelial Ovarian Cancer. Mol Cancer Res. 2020 Jan;18(1):79-90. doi: 10.1158/1541-7786.MCR-19-0691. Epub 2019 Oct 22.