Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10313)
Regulator Name Perilipin-2 (PLIN2)
Synonyms
ADFP; Adipophilin; Adipose differentiation-related protein
    Click to Show/Hide
Gene Name PLIN2
Gene ID 123
Regulator Type Protein coding
Uniprot ID Q99541
Sequence
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSV
AMTSALPIIQKLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVT
TTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENAL
TKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVK
EAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDES
HCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNA
ASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA
EMDKSSQETQRSEHKTH

    Click to Show/Hide
Family Perilipin family
Function
Structural component of lipid droplets, which is required for the formation and maintenance of lipid storage droplets.

    Click to Show/Hide
HGNC ID
HGNC:248
KEGG ID hsa:123
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PLIN2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Polyunsaturated fatty acid lipoxygenase ALOX15 (ALOX15) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
SGC7901 cell line transfected with OvPLIN2, ShPLIN2 and Control were injected subcutaneously into the nude mice (BALB/c nu/nu, female, 5 weeks old, Beijing Huafukang Biotechnology Co. Ltd. China) which were anaesthetized with 1% Sodium pentobarbital. The long diameter a and short diameter b of mouse tumor and the weights were measured every 4-5 days, and the relative tumor volumes (RTV) were calculated according to formula 0.5 x a x b x b.

    Click to Show/Hide
Response regulation Overexpression and knockdown of PLIN2 augmented the proliferation and apoptosis of gastric carcinoma cell lines SGC7901 and MGC803, respectively. PLIN2 modulated Ferroptosis pathway through regulating transcription factors-PRDM11 and IPO7:ACSL3 was a critical gene involved in abnormal lipid metabolism, ALOX15 facilitated apoptosis and necrosis.
Fatty acid CoA ligase Acsl3 (ACSL3) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver/Suppressor
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
SGC7901 cell line transfected with OvPLIN2, ShPLIN2 and Control were injected subcutaneously into the nude mice (BALB/c nu/nu, female, 5 weeks old, Beijing Huafukang Biotechnology Co. Ltd. China) which were anaesthetized with 1% Sodium pentobarbital. The long diameter a and short diameter b of mouse tumor and the weights were measured every 4-5 days, and the relative tumor volumes (RTV) were calculated according to formula 0.5 x a x b x b.

    Click to Show/Hide
Response regulation Overexpression and knockdown of PLIN2 augmented the proliferation and apoptosis of gastric carcinoma cell lines SGC7901 and MGC803, respectively. PLIN2 modulated Ferroptosis pathway through regulating transcription factors-PRDM11 and IPO7:ACSL3 was a critical gene involved in abnormal lipid metabolism, ALOX15 facilitated apoptosis and necrosis.
Gastric cancer [ICD-11: 2B72]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Perilipin-2 (PLIN2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
SGC7901 cell line transfected with OvPLIN2, ShPLIN2 and Control were injected subcutaneously into the nude mice (BALB/c nu/nu, female, 5 weeks old, Beijing Huafukang Biotechnology Co. Ltd. China) which were anaesthetized with 1% Sodium pentobarbital. The long diameter a and short diameter b of mouse tumor and the weights were measured every 4-5 days, and the relative tumor volumes (RTV) were calculated according to formula 0.5 x a x b x b.

    Click to Show/Hide
Response regulation Overexpression and knockdown of PLIN2 augmented the proliferation and apoptosis of gastric carcinoma cell lines SGC7901 and MGC803, respectively. PLIN2 modulated Ferroptosis pathway through regulating transcription factors-PRDM11 and IPO7:ACSL3 was a critical gene involved in abnormal lipid metabolism, ALOX15 facilitated apoptosis and necrosis.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Perilipin-2 (PLIN2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
SGC7901 cell line transfected with OvPLIN2, ShPLIN2 and Control were injected subcutaneously into the nude mice (BALB/c nu/nu, female, 5 weeks old, Beijing Huafukang Biotechnology Co. Ltd. China) which were anaesthetized with 1% Sodium pentobarbital. The long diameter a and short diameter b of mouse tumor and the weights were measured every 4-5 days, and the relative tumor volumes (RTV) were calculated according to formula 0.5 x a x b x b.

    Click to Show/Hide
Response regulation Overexpression and knockdown of PLIN2 augmented the proliferation and apoptosis of gastric carcinoma cell lines SGC7901 and MGC803, respectively. PLIN2 modulated Ferroptosis pathway through regulating transcription factors-PRDM11 and IPO7:ACSL3 was a critical gene involved in abnormal lipid metabolism, ALOX15 facilitated apoptosis and necrosis.
References
Ref 1 The modification of ferroptosis and abnormal lipometabolism through overexpression and knockdown of potential prognostic biomarker perilipin2 in gastric carcinoma. Gastric Cancer. 2020 Mar;23(2):241-259. doi: 10.1007/s10120-019-01004-z. Epub 2019 Sep 13.