Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10295)
Regulator Name E3 ubiquitin-protein ligase MIB2 (MIB2)
Synonyms
SKD, ZZANK1; Mind bomb homolog 2; Novel zinc finger protein; Putative NF-kappa-B-activating protein 002N; RING-type E3 ubiquitin transferase MIB2; Skeletrophin; Zinc finger ZZ type with ankyrin repeat domain protein 1
    Click to Show/Hide
Gene Name MIB2
Gene ID 142678
Regulator Type Protein coding
Uniprot ID Q96AX9
Sequence
MDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGT
RTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYM
HNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGK
PGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRL
GKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRIT
DRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPA
LGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVAL
DKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVEL
IRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQ
RGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQG
FTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCD
VNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVAD
GAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEG
RVLKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELAL
LVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQS
RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV

    Click to Show/Hide
Function
E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors.

    Click to Show/Hide
HGNC ID
HGNC:30577
KEGG ID hsa:142678
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MIB2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Cognition disorder ICD-11: MB21
 Disease Info 
Responsed Drug Sevoflurane Approved
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 mPRs (Mouse primary neurons)
In Vivo Model
Male C57BL/6 mice were obtained from Beijing HFK Bioscience Co., Ltd., China. The mice were then randomly separated into sham and sevoflurane administrated (SEV) groups, with each group containing 20 animals. In SEV groups, mice were placed in an anesthetizing chamber and exposed to 2.5% sevoflurane (CAS No. 28523-86-6, no. S2464, Selleck, Shanghai, China) with complete oxygen for 2 h, and sham group mice were conducted with the same procedure without sevoflurane exposure.

    Click to Show/Hide
Response regulation Postoperative cognitive dysfunction (POCD) is a complication of the central nervous system (CNS) often occurred after surgery or anesthesia in the elder patients. Downregulation of MIB2 could alleviate the sevoflurane-anesthesia-induced cognitive dysfunction and neuron injury through reducing ferroptosis via GPX4.
Cognition disorder [ICD-11: MB21]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator E3 ubiquitin-protein ligase MIB2 (MIB2) Protein coding
 Regulator Info 
Responsed Drug Sevoflurane Approved
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 mPRs (Mouse primary neurons)
In Vivo Model
Male C57BL/6 mice were obtained from Beijing HFK Bioscience Co., Ltd., China. The mice were then randomly separated into sham and sevoflurane administrated (SEV) groups, with each group containing 20 animals. In SEV groups, mice were placed in an anesthetizing chamber and exposed to 2.5% sevoflurane (CAS No. 28523-86-6, no. S2464, Selleck, Shanghai, China) with complete oxygen for 2 h, and sham group mice were conducted with the same procedure without sevoflurane exposure.

    Click to Show/Hide
Response regulation Postoperative cognitive dysfunction (POCD) is a complication of the central nervous system (CNS) often occurred after surgery or anesthesia in the elder patients. Downregulation of MIB2 could alleviate the sevoflurane-anesthesia-induced cognitive dysfunction and neuron injury through reducing ferroptosis via GPX4.
Sevoflurane [Approved]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Phospholipid hydroperoxide glutathione peroxidase (GPX4) Suppressor
 Target Info 
Responsed Disease Cognition disorder ICD-11: MB21
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 mPRs (Mouse primary neurons)
In Vivo Model
Male C57BL/6 mice were obtained from Beijing HFK Bioscience Co., Ltd., China. The mice were then randomly separated into sham and sevoflurane administrated (SEV) groups, with each group containing 20 animals. In SEV groups, mice were placed in an anesthetizing chamber and exposed to 2.5% sevoflurane (CAS No. 28523-86-6, no. S2464, Selleck, Shanghai, China) with complete oxygen for 2 h, and sham group mice were conducted with the same procedure without sevoflurane exposure.

    Click to Show/Hide
Response regulation Postoperative cognitive dysfunction (POCD) is a complication of the central nervous system (CNS) often occurred after surgery or anesthesia in the elder patients. Downregulation of MIB2 could alleviate the sevoflurane-anesthesia-induced cognitive dysfunction and neuron injury through reducing ferroptosis via GPX4.
References
Ref 1 Participation of Mind Bomb-2 in Sevoflurane Anesthesia Induces Cognitive Impairment in Aged Mice via Modulating Ferroptosis. ACS Chem Neurosci. 2021 Jul 7;12(13):2399-2408. doi: 10.1021/acschemneuro.1c00131. Epub 2021 Jun 13.