General Information of the Ferroptosis Regulator (ID: REG10284)
Regulator Name Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1)
Synonyms
MOSP, PLIP; PTEN-like phosphatase; Phosphoinositide lipid phosphatase; Protein-tyrosine phosphatase mitochondrial 1
    Click to Show/Hide
Gene Name PTPMT1
Gene ID 114971
Regulator Type Protein coding
Uniprot ID Q8WUK0
Sequence
MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITARATKDGTFVISKT

    Click to Show/Hide
Family Protein-tyrosine phosphatase family
Function
Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. Has also been shown to display phosphatase activity toward phosphoprotein substrates, specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells. May prevent intrinsic apoptosis, probably by regulating mitochondrial membrane integrity.

    Click to Show/Hide
HGNC ID
HGNC:26965
KEGG ID hsa:114971
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PTPMT1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Long-chain-fatty-acid--CoA ligase 4 (ACSL4) [Driver]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Pancreatic cancer ICD-11: 2C10
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation PTPMT1 is upregulated in PDAC and PTPMT1 inhibits ferroptosis by suppressing the expression of ACSL4 and upregulating SLC7A11 in Panc-1 cells, suggesting PTPMT1 might be a potential prognosis biomarker and therapeutic target in pancreatic cancer.
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Pancreatic cancer ICD-11: 2C10
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation PTPMT1 is upregulated in pancreatic cancer and PTPMT1 inhibits ferroptosis by suppressing the expression of ACSL4 and upregulating SLC7A11 in Panc-1 cells, suggesting PTPMT1 might be a potential prognosis biomarker and therapeutic target in PDAC.
Pancreatic cancer [ICD-11: 2C10]
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation PTPMT1 is upregulated in PDAC and PTPMT1 inhibits ferroptosis by suppressing the expression of ACSL4 and upregulating SLC7A11 in Panc-1 cells, suggesting PTPMT1 might be a potential prognosis biomarker and therapeutic target in pancreatic cancer.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation PTPMT1 is upregulated in pancreatic cancer and PTPMT1 inhibits ferroptosis by suppressing the expression of ACSL4 and upregulating SLC7A11 in Panc-1 cells, suggesting PTPMT1 might be a potential prognosis biomarker and therapeutic target in PDAC.
References
Ref 1 Protein tyrosine phosphatase 1 protects human pancreatic cancer from erastin-induced ferroptosis. Asian J Surg. 2022 Nov;45(11):2214-2223. doi: 10.1016/j.asjsur.2021.11.048. Epub 2022 Jan 6.