Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10234)
Regulator Name Carbonic anhydrase 9 (CA9)
Synonyms
G250, MN; Carbonate dehydratase IX; Carbonic anhydrase IX; Membrane antigen MN; P54/58N; Renal cell carcinoma-associated antigen G250; pMW1
    Click to Show/Hide
Gene Name CA9
Gene ID 768
Regulator Type Protein coding
Uniprot ID Q16790
Sequence
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG
DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL
ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT
VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA
EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS
DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF
GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA

    Click to Show/Hide
Family Alpha-carbonic anhydrase family
Function
Catalyzes the interconversion between carbon dioxide and water and the dissociated ions of carbonic acid (i.e. bicarbonate and hydrogen ions).

    Click to Show/Hide
HGNC ID
HGNC:1383
KEGG ID hsa:768
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CA9 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Solute carrier family 40 member 1 (SLC40A1) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Pleural mesothelioma ICD-11: 2C26
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
Cell migration
In Vitro Model
 ACC-MESO1 cells Pleural mesothelioma Homo sapiens CVCL_5113
NCI-H2373 cells Pleural mesothelioma Homo sapiens CVCL_A533
NCI-H2052 cells Pleural mesothelioma Homo sapiens CVCL_1518
MET-5A cells Normal Homo sapiens CVCL_3749
Response regulation CA9 suppression by inhibitors (S4 and U104) decreased viability and migration of MM cells, accompanied by overexpression of TFRC, IREB1/2 and FPN1(SLC40A1) and by downregulation of FTH/FTL in Pleural mesothelioma.
Pleural mesothelioma [ICD-11: 2C26]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Carbonic anhydrase 9 (CA9) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
Cell migration
In Vitro Model
 ACC-MESO1 cells Pleural mesothelioma Homo sapiens CVCL_5113
NCI-H2373 cells Pleural mesothelioma Homo sapiens CVCL_A533
NCI-H2052 cells Pleural mesothelioma Homo sapiens CVCL_1518
MET-5A cells Normal Homo sapiens CVCL_3749
Response regulation CA9 suppression by inhibitors (S4 and U104) decreased viability and migration of MM cells, accompanied by overexpression of TFRC, IREB1/2 and FPN1(SLC40A1) and by downregulation of FTH/FTL in Pleural mesothelioma.
References
Ref 1 Carbonic anhydrase 9 confers resistance to ferroptosis/apoptosis in malignant mesothelioma under hypoxia. Redox Biol. 2019 Sep;26:101297. doi: 10.1016/j.redox.2019.101297. Epub 2019 Aug 10.