Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10225)
Regulator Name Coiled-coil domain-containing protein 6 (CCDC6)
Synonyms
D10S170, TST1; Papillary thyroid carcinoma-encoded protein; Protein H4
    Click to Show/Hide
Gene Name CCDC6
Gene ID 8030
Regulator Type Protein coding
Uniprot ID Q16204
Sequence
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGGKSGGIVISPFRLEELT
NRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKI
QALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKK
LENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVS
APPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREE
NLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSP
SSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSP
DKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP

    Click to Show/Hide
HGNC ID
HGNC:18782
KEGG ID hsa:8030
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CCDC6 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Testicular cancer ICD-11: 2C80
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NTERA-2 cells Embryonal carcinoma Homo sapiens CVCL_0034
TM4 cells Normal Mus musculus CVCL_4327
MZ-GC-1 cells Gastric adenocarcinoma Homo sapiens CVCL_4U28
MZ-GC-2 cells Gastric adenocarcinoma Homo sapiens CVCL_4U29
Response regulation Testicular cancers are among the most common malignancies in young males. The loss of CCDC6 was associated with an enhancement of the xCT/SLC7A11 cystine antiporter expression which, by promoting the accumulation of ROS, interfered with the activation of ferroptosis pathway.
Testicular cancer [ICD-11: 2C80]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Coiled-coil domain-containing protein 6 (CCDC6) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NTERA-2 cells Embryonal carcinoma Homo sapiens CVCL_0034
TM4 cells Normal Mus musculus CVCL_4327
MZ-GC-1 cells Gastric adenocarcinoma Homo sapiens CVCL_4U28
MZ-GC-2 cells Gastric adenocarcinoma Homo sapiens CVCL_4U29
Response regulation Testicular cancers are among the most common malignancies in young males. The loss of CCDC6 was associated with an enhancement of the xCT/SLC7A11 cystine antiporter expression which, by promoting the accumulation of ROS, interfered with the activation of ferroptosis pathway.
References
Ref 1 The tumour suppressor CCDC6 is involved in ROS tolerance and neoplastic transformation by evading ferroptosis. Heliyon. 2021 Nov 15;7(11):e08399. doi: 10.1016/j.heliyon.2021.e08399. eCollection 2021 Nov.