Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10204)
Regulator Name Sterol regulatory element-binding protein 2
Synonyms
Class D basic helix-loop-helix protein 2; Sterol regulatory element-binding transcription factor 2
    Click to Show/Hide
Gene ID 6721
Regulator Type Protein coding
Uniprot ID Q12772
Sequence
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGS
GSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTS
VPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQV
LQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVP
VLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGT
DAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLK
IEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRS
RILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLL
LWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAK
TSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTA
AMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSA
AKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEY
LKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSG
ATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRR
LAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRER
ATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAA
S

    Click to Show/Hide
Family SREBP family
Function
Precursor of the transcription factor form (Processed sterol regulatory element- binding protein 2), which is embedded in the endoplasmic reticulum membrane. Low sterol concentrations promote processing of this form, releasing the transcription factor form that translocates into the nucleus and activates transcription of genes involved in cholesterol biosynthesis.

    Click to Show/Hide
HGNC ID
HGNC:11290
KEGG ID hsa:6721
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
Sterol regulatory element-binding protein 2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Knee osteoarthritis ICD-11: FA01
 Disease Info 
Responsed Drug Stigmasterol Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 ATDC-5 cells Teratocarcinoma Mus musculus CVCL_3894
Response regulation Stigmasterol (STM) attenuates chondrocyte injury induced by IL-1 by regulating ferroptosis via down-regulation of SREBF2, which suggests that STM may have potential as a novel therapeutic method for knee osteoarthritis.
Serotransferrin (TF) [Driver; Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Target for Ferroptosis Marker/Suppressor/Driver
Responsed Disease Melanoma ICD-11: 2C30
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell metastasis
In Vitro Model
 hCTCs (Human circulating tumor cells)
IGR-37 cells Melanoma Homo sapiens CVCL_2075
SK-MEL-28 cells Cutaneous melanoma Homo sapiens CVCL_0526
GAK cells Vulvar melanoma Homo sapiens CVCL_1225
A-375 cells Amelanotic melanoma Homo sapiens CVCL_0132
In Vivo Model
For primary tumorigenesis assays, NOD-scid Il2rg-/-mice (6-8 weeks old, female) were injected subcutaneously in the left flank with cultured CTCs, and tumors were harvested when they reached 2 centimeters in diameter.

    Click to Show/Hide
Response regulation The lipogenesis regulator SREBP2 directly induces transcription of the iron carrier Transferrin (TF), reducing intracellular iron pools, reactive oxygen species, and lipid peroxidation, thereby conferring resistance to inducers of ferroptosis. SREBP2-driven iron homeostatic pathways contribute to cancer progression, drug resistance, and metastasis in melanoma cancers.
Melanoma [ICD-11: 2C30]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Sterol regulatory element-binding protein 2 Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell metastasis
In Vitro Model
 hCTCs (Human circulating tumor cells)
IGR-37 cells Melanoma Homo sapiens CVCL_2075
SK-MEL-28 cells Cutaneous melanoma Homo sapiens CVCL_0526
GAK cells Vulvar melanoma Homo sapiens CVCL_1225
A-375 cells Amelanotic melanoma Homo sapiens CVCL_0132
In Vivo Model
For primary tumorigenesis assays, NOD-scid Il2rg-/-mice (6-8 weeks old, female) were injected subcutaneously in the left flank with cultured CTCs, and tumors were harvested when they reached 2 centimeters in diameter.

    Click to Show/Hide
Response regulation The lipogenesis regulator SREBP2 directly induces transcription of the iron carrier Transferrin (TF), reducing intracellular iron pools, reactive oxygen species, and lipid peroxidation, thereby conferring resistance to inducers of ferroptosis. SREBP2-driven iron homeostatic pathways contribute to cancer progression, drug resistance, and metastasis in melanoma cancers.
Knee osteoarthritis [ICD-11: FA01]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Sterol regulatory element-binding protein 2 Protein coding
 Regulator Info 
Responsed Drug Stigmasterol Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 ATDC-5 cells Teratocarcinoma Mus musculus CVCL_3894
Response regulation Stigmasterol (STM) attenuates chondrocyte injury induced by IL-1 by regulating ferroptosis via down-regulation of SREBF2, which suggests that STM may have potential as a novel therapeutic method for knee osteoarthritis.
Stigmasterol [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Suppressor
Response Target Unspecific Target
Responsed Disease Knee osteoarthritis ICD-11: FA01
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 ATDC-5 cells Teratocarcinoma Mus musculus CVCL_3894
Response regulation Stigmasterol (STM) attenuates chondrocyte injury induced by IL-1 by regulating ferroptosis via down-regulation of SREBF2, which suggests that STM may have potential as a novel therapeutic method for knee osteoarthritis.
References
Ref 1 Stigmasterol alleviates interleukin-1beta-induced chondrocyte injury by down-regulatingsterol regulatory element binding transcription factor 2 to regulateferroptosis. Bioengineered. 2021 Dec;12(2):9332-9340. doi: 10.1080/21655979.2021.2000742.
Ref 2 The Lipogenic Regulator SREBP2 Induces Transferrin in Circulating Melanoma Cells and Suppresses Ferroptosis. Cancer Discov. 2021 Mar;11(3):678-695. doi: 10.1158/2159-8290.CD-19-1500. Epub 2020 Nov 17.