General Information of the Ferroptosis Regulator (ID: REG10185)
Regulator Name ADP-ribosylation factor 6 (ARF6)
Gene Name ARF6
Gene ID 382
Regulator Type Protein coding
Uniprot ID P62330
Sequence
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS

    Click to Show/Hide
Family Arf family
Function
GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization. Regulates surface levels of adherens junction proteins such as CDH1. Required for NTRK1 sorting to the recycling pathway from early endosomes.

    Click to Show/Hide
HGNC ID
HGNC:659
KEGG ID hsa:382
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ARF6 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Long-chain-fatty-acid--CoA ligase 4 (ACSL4) [Driver]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Pancreatic cancer ICD-11: 2C10
Pathway Response Ferroptosis hsa04216
Ras signaling pathway hsa04014
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
HPDE6-C7 cells Normal Homo sapiens CVCL_0P38
AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
BxPC-3 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
Capan-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation ARF6, functioned as a downstream of Kras/ERK signaling pathway, could promote proliferation and Warburg effect in pancreatic cancer cells. ARF6 decreased ACSL4 protein level and this effect endowed pancreatic cancer cells to a status that sensitized to oxidative stress.
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Gastric cancer ICD-11: 2B72
Pathway Response Ferroptosis hsa04216
Ras signaling pathway hsa04014
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
GES-1 cells Normal Homo sapiens CVCL_EQ22
SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
BGC-823 cells Gastric carcinoma Homo sapiens CVCL_3360
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
SNU-1 cells Gastric adenocarcinoma Homo sapiens CVCL_0099
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
Response regulation ARF6, as a downstream effector of the Kirsten rat sarcoma viral oncogene (Kras)/extracellular signal-regulated kinases (ERK) signaling pathway, may increase proliferation and induce the Warburg effect in gastric cancer (GC) cells. ARF6 may control capecitabine resistance via several routes.
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator ADP-ribosylation factor 6 (ARF6) Protein coding
Pathway Response Ferroptosis hsa04216
Ras signaling pathway hsa04014
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
HPDE6-C7 cells Normal Homo sapiens CVCL_0P38
AsPC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
BxPC-3 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
SW1990 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1723
Capan-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation ARF6, functioned as a downstream of Kras/ERK signaling pathway, could promote proliferation and Warburg effect in pancreatic cancer cells. ARF6 decreased ACSL4 protein level and this effect endowed pancreatic cancer cells to a status that sensitized to oxidative stress.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator ADP-ribosylation factor 6 (ARF6) Protein coding
Pathway Response Ferroptosis hsa04216
Ras signaling pathway hsa04014
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
GES-1 cells Normal Homo sapiens CVCL_EQ22
SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
BGC-823 cells Gastric carcinoma Homo sapiens CVCL_3360
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
SNU-1 cells Gastric adenocarcinoma Homo sapiens CVCL_0099
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
Response regulation ARF6, as a downstream effector of the Kirsten rat sarcoma viral oncogene (Kras)/extracellular signal-regulated kinases (ERK) signaling pathway, may increase proliferation and induce the Warburg effect in gastric cancer (GC) cells. ARF6 may control capecitabine resistance via several routes.
References
Ref 1 Abrogation of ARF6 promotes RSL3-induced ferroptosis and mitigates gemcitabine resistance in pancreatic cancer cells. Am J Cancer Res. 2020 Apr 1;10(4):1182-1193. eCollection 2020.
Ref 2 Abrogation of ARF6 in promoting erastin-induced ferroptosis and mitigating capecitabine resistance in gastric cancer cells. J Gastrointest Oncol. 2022 Jun;13(3):958-967. doi: 10.21037/jgo-22-341.