Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10124)
Regulator Name CD82 antigen (CD82)
Synonyms
KAI1, SAR2, ST6, TSPAN27; C33 antigen; IA4; Inducible membrane protein R2; Metastasis suppressor Kangai-1; Suppressor of tumorigenicity 6 protein; Tetraspanin-27; CD_antigen=CD82
    Click to Show/Hide
Gene Name CD82
Gene ID 3732
Regulator Type Protein coding
Uniprot ID P27701
Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI
GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI
VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG
EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI
IELLGMVLSICLCRHVHSEDYSKVPKY

    Click to Show/Hide
Family Tetraspanin (TM4SF) family
Function
Associates with CD4 or CD8 and delivers costimulatory signals for the TCR/CD3 pathway.

    Click to Show/Hide
HGNC ID
HGNC:6210
KEGG ID hsa:3732
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CD82 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Solute carrier family 40 member 1 (SLC40A1) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation High expression of the KAI1 (CD82) gene promoted the occurrence of ferroptosis in pancreatic cancer cells through its extensive effect on FPN and GPX4. KAI1induced ferroptosis did not significantly inhibit the proliferation of PC cells.
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation High expression of the KAI1 (CD82) gene promoted the occurrence of ferroptosis in pancreatic cancer cells through its extensive effect on FPN and GPX4. KAI1induced ferroptosis did not significantly inhibit the proliferation of PC cells.
Pancreatic cancer [ICD-11: 2C10]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator CD82 antigen (CD82) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation High expression of the KAI1 (CD82) gene promoted the occurrence of ferroptosis in pancreatic cancer cells through its extensive effect on FPN and GPX4. KAI1induced ferroptosis did not significantly inhibit the proliferation of PC cells.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator CD82 antigen (CD82) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response regulation High expression of the KAI1 (CD82) gene promoted the occurrence of ferroptosis in pancreatic cancer cells through its extensive effect on FPN and GPX4. KAI1induced ferroptosis did not significantly inhibit the proliferation of PC cells.
References
Ref 1 Effects of KAI gene expression on ferroptosis in pancreatic cancer cells. Mol Med Rep. 2021 Feb;23(2):163. doi: 10.3892/mmr.2020.11802. Epub 2020 Dec 22.