General Information of the Ferroptosis Regulator (ID: REG10108)
Regulator Name Gap junction alpha-1 protein (GJA1)
Synonyms
GJAL; Connexin-43; Gap junction 43 kDa heart protein
    Click to Show/Hide
Gene Name GJA1
Gene ID 2697
Regulator Type Protein coding
Uniprot ID P17302
Sequence
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
VNVDMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSIFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI

    Click to Show/Hide
Family Connexin family
Function
Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles.

    Click to Show/Hide
HGNC ID
HGNC:4274
KEGG ID hsa:2697
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
GJA1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
In total 2 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Acute kidney failure ICD-11: GB60
Responsed Drug GAP 27 Investigative
Pathway Response Fatty acid metabolism hsa01212
Glutathione metabolism hsa00480
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Thirty-two male C57BL/6 mice (20 ± 2) g (Beijing Weitonglihua Experimental Animal Technology Co., Ltd.) were bred in individually ventilated cages (IVC) at SPF conditions, kept on a 12 h light/dark cycle, relative humidity conditions (40-70%) and controlled temperature (24 ± 2 ). After one-week acclimation mice were divided randomly into four groups: control group, cisplatin group (20 mg/kg cisplatin dissolved in saline), cisplatin + Fer-1 group (5 mg/kg Fer-1 dissolved in DMSO), and cisplatin + gap27 group (35 ug/kg gap27 dissolved in DMSO). There were eight animals in each group and 20 mg/kg cisplatin was given to each animal once by intraperitoneal injection except mice in the control group. Fer-1 and gap27 was administered 1 h before the injection of cisplatin.

    Click to Show/Hide
Response regulation Downregulation of Cx43 expression by gap27 reduced acute kidney injury in the animal model by inhibiting cisplatin-induced ferroptosis. Therefore, our results indicated that downregulation of Cx43 can inhibit ferroptosis by restoring the level of SLC7A11 in the system xctransporter and alleviate cisplatin-induced acute kidney injury.
Experiment 2 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Acute kidney failure ICD-11: GB60
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Thirty-two male C57BL/6 mice (20 ± 2) g (Beijing Weitonglihua Experimental Animal Technology Co., Ltd.) were bred in individually ventilated cages (IVC) at SPF conditions. After one-week acclimation mice were divided randomly into four groups: control group, cisplatin group (20 mg/kg cisplatin dissolved in saline), cisplatin + Fer-1 group (5 mg/kg Fer-1 dissolved in DMSO), and cisplatin + gap27 group (35 ug/kg gap27 dissolved in DMSO). There were eight animals in each group and 20 mg/kg cisplatin was given to each animal once by intraperitoneal injection except mice in the control group. Fer-1 and gap27 was administered 1 h before the injection of cisplatin.

    Click to Show/Hide
Response regulation Downregulation of Cx43 ( GJA1) can inhibit ferroptosis by restoring the level of SLC7A11 in the system xctransporter and alleviate cisplatin-induced acute kidney injury. And downregulating Cx43 not only inhibits ferroptosis, but also inhibits apoptosis.
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Left ventricular failure ICD-11: BD11
Responsed Drug Levosimendan Approved
Pathway Response Glutathione metabolism hsa00480
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
rHTs (Rat hippocampal tissues)
In Vivo Model
We purchased forty-eight 3-week-old male C57BL/6N mice from Beijing HFK Bioscience Co. Ltd. and gave a twelve-hour light and dark cycle starting from 06:00 (am) to 18:00 (pm). Mice were randomly assigned into three groups after 2 weeks of adaptive feeding as follows. (1) The control group (n = 16): mice were provided with normal drinking water, a normal diet and intraperitoneal administration of solvent (5% DMSO + 40% Peg300 + 5% Tween 80 + 50% ddH2O) 3 mL/kg once a week aged 13 to 17 weeks. (2) The HFpEF group (n = 16): a double-hit model was designed, in which metabolic and mechanical stress worked together and resulted in HFpEF. Briefly, C57BL/6N mice had unrestricted access to a high-fat diet (HFD, D12492, Research Diet) starting from 5 weeks old. Meanwhile, a nitric oxide synthase inhibitor, N (gamma)-nitro-L-arginine methyl ester (L-NAME) (N5751, Sigma) was supplied in drinking water (0.5 g/L) for HFpEF groups, and the pH of the drinking water was adjusted to 7.4. The above placebo solvent was administrated in the same manner. (3) The HFpEF + Levo group (n = 16): according to the previous study, HFpEF mice received 3 mg/kg levosimendan (S2446, Selleck) (Dissolve 1 mg of levosimendan in 50 uL of DMSO, subsequently dilute to 1 mg/mL with the above solvent) intraperitoneally once a week from week 13 to 17.

    Click to Show/Hide
Response regulation Levosimendan reversed mitochondrial malfunction in HFpEF mice, as evidenced by increased mitofilin and decreased ROS, superoxide anion, NOX4, and cytochrome C levels. Interestingly, after levosimendan administration, myocardial tissue from HFpEF mice showed restricted ferroptosis, indicated by an increased GSH/GSSG ratio; upregulated GPX4, xCT, and FSP-1 expression; and reduced intracellular ferrous ion, MDA, and 4-HNE levels. Levosimendan Reverses Cardiac Malfunction and Cardiomyocyte Ferroptosis During Heart Failure with Preserved Ejection Fraction via Connexin 43 Signaling Activation.
Acute kidney failure [ICD-11: GB60]
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Gap junction alpha-1 protein (GJA1) Protein coding
Responsed Drug GAP 27 Investigative
Pathway Response Fatty acid metabolism hsa01212
Glutathione metabolism hsa00480
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Thirty-two male C57BL/6 mice (20 ± 2) g (Beijing Weitonglihua Experimental Animal Technology Co., Ltd.) were bred in individually ventilated cages (IVC) at SPF conditions, kept on a 12 h light/dark cycle, relative humidity conditions (40-70%) and controlled temperature (24 ± 2 ). After one-week acclimation mice were divided randomly into four groups: control group, cisplatin group (20 mg/kg cisplatin dissolved in saline), cisplatin + Fer-1 group (5 mg/kg Fer-1 dissolved in DMSO), and cisplatin + gap27 group (35 ug/kg gap27 dissolved in DMSO). There were eight animals in each group and 20 mg/kg cisplatin was given to each animal once by intraperitoneal injection except mice in the control group. Fer-1 and gap27 was administered 1 h before the injection of cisplatin.

    Click to Show/Hide
Response regulation Downregulation of Cx43 expression by gap27 reduced acute kidney injury in the animal model by inhibiting cisplatin-induced ferroptosis. Therefore, our results indicated that downregulation of Cx43 can inhibit ferroptosis by restoring the level of SLC7A11 in the system xctransporter and alleviate cisplatin-induced acute kidney injury.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Gap junction alpha-1 protein (GJA1) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Thirty-two male C57BL/6 mice (20 ± 2) g (Beijing Weitonglihua Experimental Animal Technology Co., Ltd.) were bred in individually ventilated cages (IVC) at SPF conditions. After one-week acclimation mice were divided randomly into four groups: control group, cisplatin group (20 mg/kg cisplatin dissolved in saline), cisplatin + Fer-1 group (5 mg/kg Fer-1 dissolved in DMSO), and cisplatin + gap27 group (35 ug/kg gap27 dissolved in DMSO). There were eight animals in each group and 20 mg/kg cisplatin was given to each animal once by intraperitoneal injection except mice in the control group. Fer-1 and gap27 was administered 1 h before the injection of cisplatin.

    Click to Show/Hide
Response regulation Downregulation of Cx43 ( GJA1) can inhibit ferroptosis by restoring the level of SLC7A11 in the system xctransporter and alleviate cisplatin-induced acute kidney injury. And downregulating Cx43 not only inhibits ferroptosis, but also inhibits apoptosis.
Left ventricular failure [ICD-11: BD11]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Gap junction alpha-1 protein (GJA1) Protein coding
Responsed Drug Levosimendan Approved
Pathway Response Glutathione metabolism hsa00480
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
rHTs (Rat hippocampal tissues)
In Vivo Model
We purchased forty-eight 3-week-old male C57BL/6N mice from Beijing HFK Bioscience Co. Ltd. and gave a twelve-hour light and dark cycle starting from 06:00 (am) to 18:00 (pm). Mice were randomly assigned into three groups after 2 weeks of adaptive feeding as follows. (1) The control group (n = 16): mice were provided with normal drinking water, a normal diet and intraperitoneal administration of solvent (5% DMSO + 40% Peg300 + 5% Tween 80 + 50% ddH2O) 3 mL/kg once a week aged 13 to 17 weeks. (2) The HFpEF group (n = 16): a double-hit model was designed, in which metabolic and mechanical stress worked together and resulted in HFpEF. Briefly, C57BL/6N mice had unrestricted access to a high-fat diet (HFD, D12492, Research Diet) starting from 5 weeks old. Meanwhile, a nitric oxide synthase inhibitor, N (gamma)-nitro-L-arginine methyl ester (L-NAME) (N5751, Sigma) was supplied in drinking water (0.5 g/L) for HFpEF groups, and the pH of the drinking water was adjusted to 7.4. The above placebo solvent was administrated in the same manner. (3) The HFpEF + Levo group (n = 16): according to the previous study, HFpEF mice received 3 mg/kg levosimendan (S2446, Selleck) (Dissolve 1 mg of levosimendan in 50 uL of DMSO, subsequently dilute to 1 mg/mL with the above solvent) intraperitoneally once a week from week 13 to 17.

    Click to Show/Hide
Response regulation Levosimendan reversed mitochondrial malfunction in HFpEF mice, as evidenced by increased mitofilin and decreased ROS, superoxide anion, NOX4, and cytochrome C levels. Interestingly, after levosimendan administration, myocardial tissue from HFpEF mice showed restricted ferroptosis, indicated by an increased GSH/GSSG ratio; upregulated GPX4, xCT, and FSP-1 expression; and reduced intracellular ferrous ion, MDA, and 4-HNE levels. Levosimendan Reverses Cardiac Malfunction and Cardiomyocyte Ferroptosis During Heart Failure with Preserved Ejection Fraction via Connexin 43 Signaling Activation.
GAP 27 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Suppressor
Response Target Cystine/glutamate transporter (SLC7A11) Driver; Suppressor
Responsed Disease Acute kidney failure ICD-11: GB60
Pathway Response Fatty acid metabolism hsa01212
Glutathione metabolism hsa00480
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Thirty-two male C57BL/6 mice (20 ± 2) g (Beijing Weitonglihua Experimental Animal Technology Co., Ltd.) were bred in individually ventilated cages (IVC) at SPF conditions, kept on a 12 h light/dark cycle, relative humidity conditions (40-70%) and controlled temperature (24 ± 2 ). After one-week acclimation mice were divided randomly into four groups: control group, cisplatin group (20 mg/kg cisplatin dissolved in saline), cisplatin + Fer-1 group (5 mg/kg Fer-1 dissolved in DMSO), and cisplatin + gap27 group (35 ug/kg gap27 dissolved in DMSO). There were eight animals in each group and 20 mg/kg cisplatin was given to each animal once by intraperitoneal injection except mice in the control group. Fer-1 and gap27 was administered 1 h before the injection of cisplatin.

    Click to Show/Hide
Response regulation Downregulation of Cx43 expression by gap27 reduced acute kidney injury in the animal model by inhibiting cisplatin-induced ferroptosis. Therefore, our results indicated that downregulation of Cx43 can inhibit ferroptosis by restoring the level of SLC7A11 in the system xctransporter and alleviate cisplatin-induced acute kidney injury.
Levosimendan [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [2]
Drug for Ferroptosis Suppressor
Response Target Unspecific Target
Responsed Disease Left ventricular failure ICD-11: BD11
Pathway Response Glutathione metabolism hsa00480
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
rHTs (Rat hippocampal tissues)
In Vivo Model
We purchased forty-eight 3-week-old male C57BL/6N mice from Beijing HFK Bioscience Co. Ltd. and gave a twelve-hour light and dark cycle starting from 06:00 (am) to 18:00 (pm). Mice were randomly assigned into three groups after 2 weeks of adaptive feeding as follows. (1) The control group (n = 16): mice were provided with normal drinking water, a normal diet and intraperitoneal administration of solvent (5% DMSO + 40% Peg300 + 5% Tween 80 + 50% ddH2O) 3 mL/kg once a week aged 13 to 17 weeks. (2) The HFpEF group (n = 16): a double-hit model was designed, in which metabolic and mechanical stress worked together and resulted in HFpEF. Briefly, C57BL/6N mice had unrestricted access to a high-fat diet (HFD, D12492, Research Diet) starting from 5 weeks old. Meanwhile, a nitric oxide synthase inhibitor, N (gamma)-nitro-L-arginine methyl ester (L-NAME) (N5751, Sigma) was supplied in drinking water (0.5 g/L) for HFpEF groups, and the pH of the drinking water was adjusted to 7.4. The above placebo solvent was administrated in the same manner. (3) The HFpEF + Levo group (n = 16): according to the previous study, HFpEF mice received 3 mg/kg levosimendan (S2446, Selleck) (Dissolve 1 mg of levosimendan in 50 uL of DMSO, subsequently dilute to 1 mg/mL with the above solvent) intraperitoneally once a week from week 13 to 17.

    Click to Show/Hide
Response regulation Levosimendan reversed mitochondrial malfunction in HFpEF mice, as evidenced by increased mitofilin and decreased ROS, superoxide anion, NOX4, and cytochrome C levels. Interestingly, after levosimendan administration, myocardial tissue from HFpEF mice showed restricted ferroptosis, indicated by an increased GSH/GSSG ratio; upregulated GPX4, xCT, and FSP-1 expression; and reduced intracellular ferrous ion, MDA, and 4-HNE levels. Levosimendan Reverses Cardiac Malfunction and Cardiomyocyte Ferroptosis During Heart Failure with Preserved Ejection Fraction via Connexin 43 Signaling Activation.
References
Ref 1 Downregulation of Cx43 reduces cisplatin-induced acute renal injury by inhibiting ferroptosis. Food Chem Toxicol. 2021 Dec;158:112672. doi: 10.1016/j.fct.2021.112672. Epub 2021 Nov 13.
Ref 2 Levosimendan Reverses Cardiac Malfunction and Cardiomyocyte Ferroptosis During Heart Failure with Preserved Ejection Fraction via Connexin 43 Signaling Activation. Cardiovasc Drugs Ther. 2023 Mar 7. doi: 10.1007/s10557-023-07441-4. Online ahead of print.