Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10089)
Regulator Name Microsomal glutathione S-transferase 1 (MGST1)
Synonyms
GST12, MGST; Microsomal GST-I
    Click to Show/Hide
Gene Name MGST1
Gene ID 4257
Regulator Type Protein coding
Uniprot ID P10620
Sequence
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL

    Click to Show/Hide
Family MAPEG family
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

    Click to Show/Hide
HGNC ID
HGNC:7061
KEGG ID hsa:4257
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MGST1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Polyunsaturated fatty acid 5-lipoxygenase (ALOX5) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
In Vitro Model
 CFPAC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_1119
Panc 02.03 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1633
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
In Vivo Model
To generate murine subcutaneous tumors, 5 x 106 CFPAC1 cells in 100 ul PBS were injected subcutaneously to the right of the dorsal midline in 6- to 8-week-old athymic nude female mice. Once the tumors reached around 70-80 mm3 at day 7, mice were randomly allocated into groups and then treated with imidazole ketone erastin (IKE; 40 mg/kg, i.p., once every other day) in the absence or presence of liproxstatin-1 (10 mg/kg, i.p., once every other day) for 2 weeks.

    Click to Show/Hide
Response regulation MGST1 inhibits ferroptotic cancer cell death partly by binding to ALOX5, resulting in reduced lipid peroxidation. The expression of MGST1 is positively correlated with NFE2L2 expression in pancreatic tumors, which is implicated in the poor prognosis of patients with pancreatic ductal adenocarcinoma (PDAC).
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
In Vitro Model
 CFPAC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_1119
Panc 02.03 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1633
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
In Vivo Model
To generate murine subcutaneous tumors, 5 x 106 CFPAC1 cells in 100 ul PBS were injected subcutaneously to the right of the dorsal midline in 6- to 8-week-old athymic nude female mice. Once the tumors reached around 70-80 mm3 at day 7, mice were randomly allocated into groups and then treated with imidazole ketone erastin (IKE; 40 mg/kg, i.p., once every other day) in the absence or presence of liproxstatin-1 (10 mg/kg, i.p., once every other day) for 2 weeks.

    Click to Show/Hide
Response regulation MGST1 inhibits ferroptotic cancer cell death partly by binding to ALOX5, resulting in reduced lipid peroxidation. The expression of MGST1 is positively correlated with NFE2L2 expression in pancreatic tumors, which is implicated in the poor prognosis of patients with pancreatic ductal adenocarcinoma (PDAC).
Pancreatic cancer [ICD-11: 2C10]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Microsomal glutathione S-transferase 1 (MGST1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
In Vitro Model
 CFPAC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_1119
Panc 02.03 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1633
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
In Vivo Model
To generate murine subcutaneous tumors, 5 x 106 CFPAC1 cells in 100 ul PBS were injected subcutaneously to the right of the dorsal midline in 6- to 8-week-old athymic nude female mice. Once the tumors reached around 70-80 mm3 at day 7, mice were randomly allocated into groups and then treated with imidazole ketone erastin (IKE; 40 mg/kg, i.p., once every other day) in the absence or presence of liproxstatin-1 (10 mg/kg, i.p., once every other day) for 2 weeks.

    Click to Show/Hide
Response regulation MGST1 inhibits ferroptotic cancer cell death partly by binding to ALOX5, resulting in reduced lipid peroxidation. The expression of MGST1 is positively correlated with NFE2L2 expression in pancreatic tumors, which is implicated in the poor prognosis of patients with pancreatic ductal adenocarcinoma (PDAC).
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Microsomal glutathione S-transferase 1 (MGST1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Apoptosis hsa04210
Cell Process Cell ferroptosis
In Vitro Model
 CFPAC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_1119
Panc 02.03 cells Pancreatic adenocarcinoma Homo sapiens CVCL_1633
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
In Vivo Model
To generate murine subcutaneous tumors, 5 x 106 CFPAC1 cells in 100 ul PBS were injected subcutaneously to the right of the dorsal midline in 6- to 8-week-old athymic nude female mice. Once the tumors reached around 70-80 mm3 at day 7, mice were randomly allocated into groups and then treated with imidazole ketone erastin (IKE; 40 mg/kg, i.p., once every other day) in the absence or presence of liproxstatin-1 (10 mg/kg, i.p., once every other day) for 2 weeks.

    Click to Show/Hide
Response regulation MGST1 inhibits ferroptotic cancer cell death partly by binding to ALOX5, resulting in reduced lipid peroxidation. The expression of MGST1 is positively correlated with NFE2L2 expression in pancreatic tumors, which is implicated in the poor prognosis of patients with pancreatic ductal adenocarcinoma (PDAC).
References
Ref 1 MGST1 is a redox-sensitive repressor of ferroptosis in pancreatic cancer cells. Cell Chem Biol. 2021 Jun 17;28(6):765-775.e5. doi: 10.1016/j.chembiol.2021.01.006. Epub 2021 Feb 3.