Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10086)
Regulator Name Transcriptional activator Myb (MYB)
Synonyms
Proto-oncogene c-Myb
    Click to Show/Hide
Gene Name MYB
Gene ID 4602
Regulator Type Protein coding
Uniprot ID P10242
Sequence
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLT
STPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIK
YGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNF
FCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP
LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM

    Click to Show/Hide
Function
Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.

    Click to Show/Hide
HGNC ID
HGNC:7545
KEGG ID hsa:4602
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MYB can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
BGC-823 cells Gastric carcinoma Homo sapiens CVCL_3360
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
1 x 106 BGC823 control or CDO1 short hairpin (sh)RNA treated cells in 150 ul PBS were injected subcutaneously right of the dorsal midline in athymic nude mice. Once the tumors reached 80 to 100 mm3 at day 10, mice were allocated randomly into groups of five and treated with erastin (30 mg/kg intraperitoneally, twice every other day).

    Click to Show/Hide
Response regulation Silencing CDO1 inhibited erastin-induced ferroptosis in gastric cancer cells both in vitro and in vivo. Mechanistically, c-Myb (MYB) transcriptionally regulated CDO1, and inhibition of CDO1 expression upregulated GPX4 expression.
Gastric cancer [ICD-11: 2B72]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transcriptional activator Myb (MYB) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
BGC-823 cells Gastric carcinoma Homo sapiens CVCL_3360
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
SGC-7901 cells Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 cells Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
In Vivo Model
1 x 106 BGC823 control or CDO1 short hairpin (sh)RNA treated cells in 150 ul PBS were injected subcutaneously right of the dorsal midline in athymic nude mice. Once the tumors reached 80 to 100 mm3 at day 10, mice were allocated randomly into groups of five and treated with erastin (30 mg/kg intraperitoneally, twice every other day).

    Click to Show/Hide
Response regulation Silencing CDO1 inhibited erastin-induced ferroptosis in gastric cancer cells both in vitro and in vivo. Mechanistically, c-Myb (MYB) transcriptionally regulated CDO1, and inhibition of CDO1 expression upregulated GPX4 expression.
References
Ref 1 Cysteine Dioxygenase 1 Mediates Erastin-Induced Ferroptosis in Human Gastric Cancer Cells. Neoplasia. 2017 Dec;19(12):1022-1032. doi: 10.1016/j.neo.2017.10.005. Epub 2017 Nov 13.