Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10075)
Regulator Name Interleukin-6 (IL6)
Synonyms
IFNB2; B-cell stimulatory factor 2; CTL differentiation factor; Hybridoma growth factor; Interferon beta-2
    Click to Show/Hide
Gene Name IL6
Gene ID 3569
Regulator Type Protein coding
Uniprot ID P05231
Sequence
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

    Click to Show/Hide
Family IL-6 superfamily
Function
Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans- signaling'. Alternatively, 'cluster signaling' occurs when membrane- bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable).

    Click to Show/Hide
HGNC ID
HGNC:6018
KEGG ID hsa:3569
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
IL6 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Head neck squamous cell carcinoma ICD-11: 2D60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ferroptosis hsa04216
JAK-STAT signaling pathway hsa04630
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HN4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_IS30
CAL-27 cells Tongue adenosquamous carcinom Homo sapiens CVCL_1107
In Vivo Model
Four-week-old male BALB/c-nu mice were purchased from the Shanghai Laboratory Animal Center (Shanghai, China). About 4 x 106 CAL27 cells were stably transfected with lentivirus. After administration of 2 ug/mL puromycin for three days, transfection efficiency was confirmed by western blotting. Approximately 2 x 106 transfected cells were subcutaneously injected into flanks. For the drug-administration study, 20 mg/kg erastin (S7242, Selleck Chemicals) were administrated intraperitoneally twice every other day. Approximately 20 uL IL-6 (10 ug/mL, PeproTech, USA) were given intratumorally twice every other day.

    Click to Show/Hide
Response regulation The study demonstrate the critical role of IL-6-induced ferroptosis resistance during head and neck squamous cell carcinoma carcinogenesis. The IL-6/STAT3/xCT (encoded by SLC7A11) axis acts as a novel mechanism driving tumor progression and thus may potentially be utilized as a target for tumor prevention and therapy.
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Asthma ICD-11: CA23
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 BEAS-2B cells Normal Homo sapiens CVCL_0168
Response regulation Asthma occurs accompanied by the ferroptosis in bronchial epithelial cells, during which Interleukin-6 (IL-6) plays a key role. IL-6 promotes ferroptosis in bronchial epithelial cells by inducing reactive oxygen species (ROS)-dependent lipid peroxidation and disrupting iron homeostasis.
Head neck squamous cell carcinoma [ICD-11: 2D60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Interleukin-6 (IL6) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ferroptosis hsa04216
JAK-STAT signaling pathway hsa04630
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HN4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_IS30
CAL-27 cells Tongue adenosquamous carcinom Homo sapiens CVCL_1107
In Vivo Model
Four-week-old male BALB/c-nu mice were purchased from the Shanghai Laboratory Animal Center (Shanghai, China). About 4 x 106 CAL27 cells were stably transfected with lentivirus. After administration of 2 ug/mL puromycin for three days, transfection efficiency was confirmed by western blotting. Approximately 2 x 106 transfected cells were subcutaneously injected into flanks. For the drug-administration study, 20 mg/kg erastin (S7242, Selleck Chemicals) were administrated intraperitoneally twice every other day. Approximately 20 uL IL-6 (10 ug/mL, PeproTech, USA) were given intratumorally twice every other day.

    Click to Show/Hide
Response regulation The study demonstrate the critical role of IL-6-induced ferroptosis resistance during head and neck squamous cell carcinoma carcinogenesis. The IL-6/STAT3/xCT (encoded by SLC7A11) axis acts as a novel mechanism driving tumor progression and thus may potentially be utilized as a target for tumor prevention and therapy.
Asthma [ICD-11: CA23]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Interleukin-6 (IL6) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 BEAS-2B cells Normal Homo sapiens CVCL_0168
Response regulation Asthma occurs accompanied by the ferroptosis in bronchial epithelial cells, during which Interleukin-6 (IL-6) plays a key role. IL-6 promotes ferroptosis in bronchial epithelial cells by inducing reactive oxygen species (ROS)-dependent lipid peroxidation and disrupting iron homeostasis.
References
Ref 1 Interleukin-6 facilitates tumor progression by inducing ferroptosis resistance in head and neck squamous cell carcinoma. Cancer Lett. 2022 Feb 28;527:28-40. doi: 10.1016/j.canlet.2021.12.011. Epub 2021 Dec 10.
Ref 2 Interleukin-6 promotes ferroptosis in bronchial epithelial cells by inducing reactive oxygen species-dependent lipid peroxidation and disrupting iron homeostasis. Bioengineered. 2021 Dec;12(1):5279-5288. doi: 10.1080/21655979.2021.1964158.