Ferroptosis Target Information

General Information of the Ferroptosis Target (ID: TAR10025)
Target Name Glutamate--cysteine ligase catalytic subunit (GCLC)
Synonyms
GCS heavy chain; Gamma-ECS; Gamma-glutamylcysteine synthetase
    Click to Show/Hide
Gene Name GCLC
Sequence
MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN

    Click to Show/Hide
Family Glutamate-cysteine ligase type 3 family
Function
Catalyzes the ATP-dependent ligation of L-glutamate and L- cysteine and participates in the first and rate-limiting step in glutathione biosynthesis.

    Click to Show/Hide
Gene ID 2729
Uniprot ID
P48506
Target Type Driver Suppressor Marker
Mechanism Diagram Click to View the Original Diagram
Tissue Relative Abundances of This Target
Full List of Regulator(s) of This Ferroptosis Target and Corresponding Disease/Drug Response(s)
GCLC can be involved in and affect the ferroptosis by the following regulators, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulting from the regulation of certain regulators.
Browse Regulator related Disease
Browse Regulator related Drug
Unspecific Regulator
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the Ferroptosis-centered Disease Response of This Regulator [1]
Responsed Drug Andrographis Approved
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model
 MKN74 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
NUGC-4 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_3082
Response Description Andrographis exerted antitumor effects in gastric cancer cell lines (MKN74 and NUGC4) by inhibiting proliferation, reducing colony formation and enhancing apoptotic activity. Moreover, andrographis treatment altered the expression of ferroptosis-associated genes, including HMOX1, GCLC, and GCLM.
Unspecific Regulator
Andrographis [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the Ferroptosis-centered Drug Response of This Regulator [1]
Responsed Disease Gastric cancer [ICD-11: 2B72]
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Apoptosis hsa04210
Cell Process Cell ferroptosis
Cell apoptosis
Cell proliferation
In Vitro Model MKN74 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
NUGC-4 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_3082
Response Description Andrographis exerted antitumor effects in gastric cancer cell lines (MKN74 and NUGC4) by inhibiting proliferation, reducing colony formation and enhancing apoptotic activity. Moreover, andrographis treatment altered the expression of ferroptosis-associated genes, including HMOX1, GCLC, and GCLM.
References
Ref 1 Antitumor effects of Andrographis via ferroptosis-associated genes in gastric cancer. Oncol Lett. 2021 Jul;22(1):523. doi: 10.3892/ol.2021.12784. Epub 2021 May 12.