Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10516)
Regulator Name RNA binding protein fox-1 homolog 2 (RBFOX2)
Synonyms
FOX2; HRNBP2; RBM9; RTA; Fox-1 homolog B; Hexaribonucleotide-binding protein 2; RNA-binding motif protein 9; RNA-binding protein 9; Repressor of tamoxifen transcriptional activity
    Click to Show/Hide
Gene Name RBFOX2
Gene ID 23543
Regulator Type Protein coding
Uniprot ID O43251
Sequence
MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDY
AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKL
HGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLG
NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVP
PTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY

    Click to Show/Hide
Function
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue- specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.

    Click to Show/Hide
HGNC ID
HGNC:9906
KEGG ID hsa:23543
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
RBFOX2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Transferrin receptor protein 1 (TFRC) [Driver; Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor/Driver
Responsed Disease Corpus uteri cancer ICD-11: 2C76
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 KLE cells Endometrial adenocarcinoma Homo sapiens CVCL_1329
Ishikawa cells Endometrial adenocarcinoma Homo sapiens CVCL_2529
HEC-1-A cells Endometrial adenocarcinoma Homo sapiens CVCL_0293
HEC-1-B cells Endometrial adenocarcinoma Homo sapiens CVCL_0294
RL95-2 cells Endometrial adenosquamous carcinoma Homo sapiens CVCL_0505
In Vivo Model
Female 4-week-old BALB/c-nu nude mice were purchased from Vital River (Beijing, China) and housed in a specific pathogen-free facility. EC cells were washed twice with serum-free medium and injected subcutaneously into nude mice (5 x 106 cells/site). Tumors were measured with calipers every four days for four weeks. The mice were sacrificed on day 32 after cell implantation, and the tumors were excised and weighed.

    Click to Show/Hide
Response regulation CircRAPGEF5 interacts with RBFOX2, an important splicing regulator, to modulate the splicing of TFRC pre-mRNA. Importantly, circRAPGEF5 promotes exon-4 skipping of TFRC by sequestering RBFOX2, resulting in resistance to ferroptosis via the reduction of labile iron in endometrial cancer cells.
Corpus uteri cancer [ICD-11: 2C76]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator RNA binding protein fox-1 homolog 2 (RBFOX2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 KLE cells Endometrial adenocarcinoma Homo sapiens CVCL_1329
Ishikawa cells Endometrial adenocarcinoma Homo sapiens CVCL_2529
HEC-1-A cells Endometrial adenocarcinoma Homo sapiens CVCL_0293
HEC-1-B cells Endometrial adenocarcinoma Homo sapiens CVCL_0294
RL95-2 cells Endometrial adenosquamous carcinoma Homo sapiens CVCL_0505
In Vivo Model
Female 4-week-old BALB/c-nu nude mice were purchased from Vital River (Beijing, China) and housed in a specific pathogen-free facility. EC cells were washed twice with serum-free medium and injected subcutaneously into nude mice (5 x 106 cells/site). Tumors were measured with calipers every four days for four weeks. The mice were sacrificed on day 32 after cell implantation, and the tumors were excised and weighed.

    Click to Show/Hide
Response regulation CircRAPGEF5 interacts with RBFOX2, an important splicing regulator, to modulate the splicing of TFRC pre-mRNA. Importantly, circRAPGEF5 promotes exon-4 skipping of TFRC by sequestering RBFOX2, resulting in resistance to ferroptosis via the reduction of labile iron in endometrial cancer cells.
References
Ref 1 CircRAPGEF5 interacts with RBFOX2 to confer ferroptosis resistance by modulating alternative splicing of TFRC in endometrial cancer. Redox Biol. 2022 Sep 26;57:102493. doi: 10.1016/j.redox.2022.102493. Online ahead of print.