Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10509)
Regulator Name Myc proto-oncogene protein (MYC)
Synonyms
BHLHE39; Class E basic helix-loop-helix protein 39; Proto-oncogene c-Myc; Transcription factor p64
    Click to Show/Hide
Gene Name MYC
Gene ID 4609
Regulator Type Protein coding
Uniprot ID P01106
Sequence
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

    Click to Show/Hide
Function
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells (By similarity). Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity). Positively regulates transcription of HNRNPA1, HNRNPA2 and PTBP1 which in turn regulate splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform.

    Click to Show/Hide
HGNC ID
HGNC:7553
KEGG ID hsa:4609
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MYC can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Prostate cancer ICD-11: 2C82
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 cells Prostate carcinoma Homo sapiens CVCL_1045
In Vivo Model
PC3 and PC3/DR cells (5 x 106 cells) were subcutaneously injected into each flank of six-week-old male BALB/c nude mice (HFK Biotech, China). When the tumor volume reached 100 mm3, the mice were treated with Dimethyl Sulfoxide (DMSO) alone, DTX (5 mg/kg body weight, every two days) with DMSO or erastin (20 mg/kg body weight in 20 ul DMSO plus 130 ul corn oil, daily) by intraperitoneal injection.

    Click to Show/Hide
Response regulation Docetaxel (DTX)-resistant prostate cancer cells develop tolerance toward ferroptosis and that lncRNAPCAT1 promotes chemoresistance by blocking DTX-induced ferroptosis. Mechanistic studies indicated that PCAT1 activates the expression of SLC7A11 by interacting with c-Myc and sponging with miR-25-3p. In addition, TFAP2C activates PCAT1 expression to reduce ferroptosis susceptibility and enhance chemoresistance.
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
H157 cells Oral cavity Squamous cell carcinoma Homo sapiens CVCL_2458
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
Response regulation Knockdown of KDM1A inhibited the level of c-Myc and increased the concentration of malondialdehyde (MDA) and irons in human lung cancer. cells H1299 and A549. Downregulation of c-Myc could facilitate KDM1A knockdown-mediated ferroptosis.
Prostate cancer [ICD-11: 2C82]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Myc proto-oncogene protein (MYC) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 cells Prostate carcinoma Homo sapiens CVCL_1045
In Vivo Model
PC3 and PC3/DR cells (5 x 106 cells) were subcutaneously injected into each flank of six-week-old male BALB/c nude mice (HFK Biotech, China). When the tumor volume reached 100 mm3, the mice were treated with Dimethyl Sulfoxide (DMSO) alone, DTX (5 mg/kg body weight, every two days) with DMSO or erastin (20 mg/kg body weight in 20 ul DMSO plus 130 ul corn oil, daily) by intraperitoneal injection.

    Click to Show/Hide
Response regulation Docetaxel (DTX)-resistant prostate cancer cells develop tolerance toward ferroptosis and that lncRNAPCAT1 promotes chemoresistance by blocking DTX-induced ferroptosis. Mechanistic studies indicated that PCAT1 activates the expression of SLC7A11 by interacting with c-Myc and sponging with miR-25-3p. In addition, TFAP2C activates PCAT1 expression to reduce ferroptosis susceptibility and enhance chemoresistance.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Myc proto-oncogene protein (MYC) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
H157 cells Oral cavity Squamous cell carcinoma Homo sapiens CVCL_2458
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
Response regulation Knockdown of KDM1A inhibited the level of c-Myc and increased the concentration of malondialdehyde (MDA) and irons in human lung cancer. cells H1299 and A549. Downregulation of c-Myc could facilitate KDM1A knockdown-mediated ferroptosis.
References
Ref 1 TFAP2C-Mediated lncRNA PCAT1 Inhibits Ferroptosis in Docetaxel-Resistant Prostate Cancer Through c-Myc/miR-25-3p/SLC7A11 Signaling. Front Oncol. 2022 Mar 23;12:862015. doi: 10.3389/fonc.2022.862015. eCollection 2022.
Ref 2 Aberrant expression of KDM1A inhibits ferroptosis of lung cancer cells through up-regulating c-Myc. Sci Rep. 2022 Nov 10;12(1):19168. doi: 10.1038/s41598-022-23699-4.