General Information of the Ferroptosis Regulator (ID: REG10505)
Regulator Name Superoxide dismutase [Mn], mitochondrial (SOD2)
Gene Name SOD2
Regulator Type Protein coding
Uniprot ID P04179
Sequence
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

    Click to Show/Hide
Family Iron/manganese superoxide dismutase family
Function
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

    Click to Show/Hide
HGNC ID
HGNC:11180
KEGG ID hsa:6648
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SOD2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Cardiomyopathy ICD-11: BC43
Responsed Drug LCZ696 Approved
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
CHO-S/H9C2 cells Normal Cricetulus griseus CVCL_A0TS
In Vivo Model
All animal protocols were approved by the Animal Care and Use Committee of TaizhouHospital, affiliated to Zhejiang University (Taizhou, China). Twenty-four 2-month-old male Wistar rats weighing 190-220 g were purchased from the Experimental Animal Center of Basi Medicine, Zhejiang Chinese Medical University. The animals were reared under a 12 h light/12 h dark cycle at a relative humidity of 55 ± 5% and temperature of 23 ± 2 , with unrestricted access to food and water. All animals were acclimatized to laboratory conditions for 1 week before the experiments and were randomly divided into four groups: control group (CG, n = 6); LCZ696 group (LCZ, n = 6); DOX group (DOX, n = 6); and DOX + LCZ696 group (DOX + LCZ, n = 6). The CG received saline solution by gavage for 6 weeks (2 mL/day), while the treatment groups received DOX (Cat. HY-15142A, MedChemExpress, USA), LCZ696 (Cat. HY-18204A, MedChemExpress, USA), or DOX + LCZ696. DOX was administered at a dose of 2.5 mg/kg once a week for 6 weeks via tailvein injection. LCZ696 (60 mg/kg/day) was administered by gavage for 6 weeks. Body weight was measured weekly.

    Click to Show/Hide
Response regulation LCZ696 treatment increased SIRT3 expression and deacetylated its target gene SOD2, and these changes were mediated by AKT activation. Collectively, LCZ696 prevents DOX-induced cardiotoxicity by inhibiting ferroptosis via AKT/SIRT3/SOD2 signaling pathway activation.
Cardiomyopathy [ICD-11: BC43]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Superoxide dismutase [Mn], mitochondrial (SOD2) Protein coding
Responsed Drug LCZ696 Approved
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
CHO-S/H9C2 cells Normal Cricetulus griseus CVCL_A0TS
In Vivo Model
All animal protocols were approved by the Animal Care and Use Committee of TaizhouHospital, affiliated to Zhejiang University (Taizhou, China). Twenty-four 2-month-old male Wistar rats weighing 190-220 g were purchased from the Experimental Animal Center of Basi Medicine, Zhejiang Chinese Medical University. The animals were reared under a 12 h light/12 h dark cycle at a relative humidity of 55 ± 5% and temperature of 23 ± 2 , with unrestricted access to food and water. All animals were acclimatized to laboratory conditions for 1 week before the experiments and were randomly divided into four groups: control group (CG, n = 6); LCZ696 group (LCZ, n = 6); DOX group (DOX, n = 6); and DOX + LCZ696 group (DOX + LCZ, n = 6). The CG received saline solution by gavage for 6 weeks (2 mL/day), while the treatment groups received DOX (Cat. HY-15142A, MedChemExpress, USA), LCZ696 (Cat. HY-18204A, MedChemExpress, USA), or DOX + LCZ696. DOX was administered at a dose of 2.5 mg/kg once a week for 6 weeks via tailvein injection. LCZ696 (60 mg/kg/day) was administered by gavage for 6 weeks. Body weight was measured weekly.

    Click to Show/Hide
Response regulation LCZ696 treatment increased SIRT3 expression and deacetylated its target gene SOD2, and these changes were mediated by AKT activation. Collectively, LCZ696 prevents DOX-induced cardiotoxicity by inhibiting ferroptosis via AKT/SIRT3/SOD2 signaling pathway activation.
LCZ696 [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Suppressor
Response Target Unspecific Target
Responsed Disease Cardiomyopathy ICD-11: BC43
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
CHO-S/H9C2 cells Normal Cricetulus griseus CVCL_A0TS
In Vivo Model
All animal protocols were approved by the Animal Care and Use Committee of TaizhouHospital, affiliated to Zhejiang University (Taizhou, China). Twenty-four 2-month-old male Wistar rats weighing 190-220 g were purchased from the Experimental Animal Center of Basi Medicine, Zhejiang Chinese Medical University. The animals were reared under a 12 h light/12 h dark cycle at a relative humidity of 55 ± 5% and temperature of 23 ± 2 , with unrestricted access to food and water. All animals were acclimatized to laboratory conditions for 1 week before the experiments and were randomly divided into four groups: control group (CG, n = 6); LCZ696 group (LCZ, n = 6); DOX group (DOX, n = 6); and DOX + LCZ696 group (DOX + LCZ, n = 6). The CG received saline solution by gavage for 6 weeks (2 mL/day), while the treatment groups received DOX (Cat. HY-15142A, MedChemExpress, USA), LCZ696 (Cat. HY-18204A, MedChemExpress, USA), or DOX + LCZ696. DOX was administered at a dose of 2.5 mg/kg once a week for 6 weeks via tailvein injection. LCZ696 (60 mg/kg/day) was administered by gavage for 6 weeks. Body weight was measured weekly.

    Click to Show/Hide
Response regulation LCZ696 treatment increased SIRT3 expression and deacetylated its target gene SOD2, and these changes were mediated by AKT activation. Collectively, LCZ696 prevents DOX-induced cardiotoxicity by inhibiting ferroptosis via AKT/SIRT3/SOD2 signaling pathway activation.
References
Ref 1 LCZ696 protects against doxorubicin-induced cardiotoxicity by inhibiting ferroptosis via AKT/SIRT3/SOD2 signaling pathway activation. Int Immunopharmacol. 2022 Dec;113(Pt A):109379. doi: 10.1016/j.intimp.2022.109379. Epub 2022 Oct 29.