Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10503)
Regulator Name Fatty acid-binding protein, heart (FABP3)
Synonyms
FABP11; MDGI; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; Mammary-derived growth inhibitor; Muscle fatty acid-binding protein
    Click to Show/Hide
Gene Name FABP3
Gene ID 2170
Regulator Type Protein coding
Uniprot ID P05413
Sequence
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA

    Click to Show/Hide
Family Fatty-acid binding protein (FABP) family
Function
FABPs are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

    Click to Show/Hide
HGNC ID
HGNC:3557
KEGG ID hsa:2170
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
FABP3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Lysophospholipid acyltransferase 5 (LPCAT3) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
MRC-5 cells Normal Homo sapiens CVCL_0440
In Vivo Model
All athymic nude mice (6-week-old) were purchased from Jiesijie (Shanghai, China). To generate routine cell-derived xenograft (CDX) mouse models, established LUAD cells (initial 5 x 106) were subcutaneously injected into the bilateral dorsal flank of athymic nude mice. To generate H1975/A549 cell-implanted intrapulmonary LUAD mice, athymic nude mice were intrapulmonarily injected with cells (5 x 106) under anesthesia and then intranasally administered adeno-associated virus 5 (AAV5) particles (2 x 1012 viral particles/mL, Genomeditech, Shanghai, China) 3 weeks later. To generate patient-derived xenograft (PDX) mouse models, fresh LUAD tissues with a size of 2-3 mm3 were subcutaneously implanted into athymic nude mice. After successful passage, the PDX mice were used for further studies.

    Click to Show/Hide
Response regulation Intracellular cir93-FABP3 interactions are critical to upregulate FABP3 to reduce global AA via reactions with taurine. The product of AA and taurine (i.e., NAT) prevents AA incorporation into the plasma membrane, thus further reducing the opportunity for PUFA peroxidation in the membrane. NAT reduces ACSL4, LPCAT3 and PLTP. Exosome and cir93 are critical to desensitize lung adenocarcinoma to ferroptosis.
Long-chain-fatty-acid--CoA ligase 4 (ACSL4) [Driver]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
MRC-5 cells Normal Homo sapiens CVCL_0440
In Vivo Model
All athymic nude mice (6-week-old) were purchased from Jiesijie (Shanghai, China). To generate routine cell-derived xenograft (CDX) mouse models, established LUAD cells (initial 5 x 106) were subcutaneously injected into the bilateral dorsal flank of athymic nude mice. To generate H1975/A549 cell-implanted intrapulmonary LUAD mice, athymic nude mice were intrapulmonarily injected with cells (5 x 106) under anesthesia and then intranasally administered adeno-associated virus 5 (AAV5) particles (2 x 1012 viral particles/mL, Genomeditech, Shanghai, China) 3 weeks later. To generate patient-derived xenograft (PDX) mouse models, fresh LUAD tissues with a size of 2-3 mm3 were subcutaneously implanted into athymic nude mice. After successful passage, the PDX mice were used for further studies.

    Click to Show/Hide
Response regulation Intracellular cir93FABP3 interactions are critical to upregulate FABP3 to reduce global AA via reactions with taurine. The product of AA and taurine (i.e., NAT) prevents AA incorporation into the plasma membrane, thus further reducing the opportunity for PUFA peroxidation in the membrane. NAT reduces ACSL4, LPCAT3 and PLTP. Exosome and cir93 are critical to desensitize lung adenocarcinoma to ferroptosis.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Fatty acid-binding protein, heart (FABP3) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
MRC-5 cells Normal Homo sapiens CVCL_0440
In Vivo Model
All athymic nude mice (6-week-old) were purchased from Jiesijie (Shanghai, China). To generate routine cell-derived xenograft (CDX) mouse models, established LUAD cells (initial 5 x 106) were subcutaneously injected into the bilateral dorsal flank of athymic nude mice. To generate H1975/A549 cell-implanted intrapulmonary LUAD mice, athymic nude mice were intrapulmonarily injected with cells (5 x 106) under anesthesia and then intranasally administered adeno-associated virus 5 (AAV5) particles (2 x 1012 viral particles/mL, Genomeditech, Shanghai, China) 3 weeks later. To generate patient-derived xenograft (PDX) mouse models, fresh LUAD tissues with a size of 2-3 mm3 were subcutaneously implanted into athymic nude mice. After successful passage, the PDX mice were used for further studies.

    Click to Show/Hide
Response regulation Intracellular cir93-FABP3 interactions are critical to upregulate FABP3 to reduce global AA via reactions with taurine. The product of AA and taurine (i.e., NAT) prevents AA incorporation into the plasma membrane, thus further reducing the opportunity for PUFA peroxidation in the membrane. NAT reduces ACSL4, LPCAT3 and PLTP. Exosome and cir93 are critical to desensitize lung adenocarcinoma to ferroptosis.
Experiment 2 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Fatty acid-binding protein, heart (FABP3) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 H1650-ER1 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_4V01
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 cells Lung large cell carcinoma Homo sapiens CVCL_0060
MRC-5 cells Normal Homo sapiens CVCL_0440
In Vivo Model
All athymic nude mice (6-week-old) were purchased from Jiesijie (Shanghai, China). To generate routine cell-derived xenograft (CDX) mouse models, established LUAD cells (initial 5 x 106) were subcutaneously injected into the bilateral dorsal flank of athymic nude mice. To generate H1975/A549 cell-implanted intrapulmonary LUAD mice, athymic nude mice were intrapulmonarily injected with cells (5 x 106) under anesthesia and then intranasally administered adeno-associated virus 5 (AAV5) particles (2 x 1012 viral particles/mL, Genomeditech, Shanghai, China) 3 weeks later. To generate patient-derived xenograft (PDX) mouse models, fresh LUAD tissues with a size of 2-3 mm3 were subcutaneously implanted into athymic nude mice. After successful passage, the PDX mice were used for further studies.

    Click to Show/Hide
Response regulation Intracellular cir93FABP3 interactions are critical to upregulate FABP3 to reduce global AA via reactions with taurine. The product of AA and taurine (i.e., NAT) prevents AA incorporation into the plasma membrane, thus further reducing the opportunity for PUFA peroxidation in the membrane. NAT reduces ACSL4, LPCAT3 and PLTP. Exosome and cir93 are critical to desensitize lung adenocarcinoma to ferroptosis.
References
Ref 1 Essential roles of exosome and circRNA_101093 on ferroptosis desensitization in lung adenocarcinoma. Cancer Commun (Lond). 2022 Apr;42(4):287-313. doi: 10.1002/cac2.12275. Epub 2022 Feb 20.