Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10492)
Regulator Name Homeobox protein Hox-B4 (HOXB4)
Synonyms
HOX2F; Homeobox protein Hox-2.6; Homeobox protein Hox-2F
    Click to Show/Hide
Gene Name HOXB4
Gene ID 3214
Regulator Type Protein coding
Uniprot ID P17483
Sequence
MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
TVQRYAACRDPGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPP
PCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKE
FHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSAGGP
PGRPNGGPRAL

    Click to Show/Hide
Family Antp homeobox family
Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

    Click to Show/Hide
HGNC ID
HGNC:5115
KEGG ID hsa:3214
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
HOXB4 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Acute myocardial infarction ICD-11: BA41
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HEK-293T cells Normal Homo sapiens CVCL_0063
CHO-S/H9C2 cells Normal Cricetulus griseus CVCL_A0TS
Response regulation AKR1C3 and HOXB4 are promising diagnostic biomarkers, providing novel insights into the ferroptosis mechanisms of acute myocardial infarction (AMI).
Acute myocardial infarction [ICD-11: BA41]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Homeobox protein Hox-B4 (HOXB4) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HEK-293T cells Normal Homo sapiens CVCL_0063
CHO-S/H9C2 cells Normal Cricetulus griseus CVCL_A0TS
Response regulation AKR1C3 and HOXB4 are promising diagnostic biomarkers, providing novel insights into the ferroptosis mechanisms of acute myocardial infarction (AMI).
References
Ref 1 AKR1C3 and Its Transcription Factor HOXB4 Are Promising Diagnostic Biomarkers for Acute Myocardial Infarction. Front Cardiovasc Med. 2021 Sep 9;8:694238. doi: 10.3389/fcvm.2021.694238. eCollection 2021.