Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10491)
Regulator Name Transcription factor JunD (JUND)
Synonyms
Transcription factor AP-1 subunit JunD
    Click to Show/Hide
Gene Name JUND
Gene ID 3727
Regulator Type Protein coding
Uniprot ID P17535
Sequence
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

    Click to Show/Hide
Family BZIP family
Function
Transcription factor binding AP-1 sites. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' and enhancing their transcriptional activity.

    Click to Show/Hide
HGNC ID
HGNC:6206
KEGG ID hsa:3727
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
JUND can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Ferroptosis hsa04216
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 hIBECs (Human intrahepatic biliary epithelial cells)
HuCC-T1 cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
HCCC-9810 cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_6908
QBC939 cells Cholangiocarcinoma Homo sapiens CVCL_6942
HuH-28 cells Cholangiocarcinoma Homo sapiens CVCL_2955
RBE cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
In Vivo Model
For the proliferation assays, HuCCT1 cells with linc00976 knockdown, linc00976 overexpression, and negative control were subcutaneously injected into BALB/c nude mice. The mice were weighed every week and euthanized 5 weeks after injection. Finally, tumors were dissected and weighed. For the proliferation assays, HuCCT1 cells with linc00976 knockdown, linc00976 overexpression, and negative control were subcutaneously injected into BALB/c nude mice. The mice were weighed every week and euthanized 5 weeks after injection. Finally, tumors were dissected and weighed.

    Click to Show/Hide
Response regulation JUND promotes linc00976 transcription, and linc00976 plays a crucial role in accelerating Cholangiocarcinoma tumorigenesis and metastasis and inhibiting ferroptosis by modulating the miR-3202/GPX4 axis.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transcription factor JunD (JUND) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
 hIBECs (Human intrahepatic biliary epithelial cells)
HuCC-T1 cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
HCCC-9810 cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_6908
QBC939 cells Cholangiocarcinoma Homo sapiens CVCL_6942
HuH-28 cells Cholangiocarcinoma Homo sapiens CVCL_2955
RBE cells Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
In Vivo Model
For the proliferation assays, HuCCT1 cells with linc00976 knockdown, linc00976 overexpression, and negative control were subcutaneously injected into BALB/c nude mice. The mice were weighed every week and euthanized 5 weeks after injection. Finally, tumors were dissected and weighed. For the proliferation assays, HuCCT1 cells with linc00976 knockdown, linc00976 overexpression, and negative control were subcutaneously injected into BALB/c nude mice. The mice were weighed every week and euthanized 5 weeks after injection. Finally, tumors were dissected and weighed.

    Click to Show/Hide
Response regulation JUND promotes linc00976 transcription, and linc00976 plays a crucial role in accelerating Cholangiocarcinoma tumorigenesis and metastasis and inhibiting ferroptosis by modulating the miR-3202/GPX4 axis.
References
Ref 1 JUND/linc00976 promotes cholangiocarcinoma progression and metastasis, inhibits ferroptosis by regulating the miR-3202/GPX4 axis. Cell Death Dis. 2022 Nov 18;13(11):967. doi: 10.1038/s41419-022-05412-5.