General Information of the Ferroptosis Regulator (ID: REG10481)
Regulator Name Dipeptidyl peptidase 4 (DPP4)
Synonyms
ADABP; Adenosine deaminase complexing protein 2; Dipeptidyl peptidase IV; T-cell activation antigen CD26; TP103; CD_antigen=CD26
    Click to Show/Hide
Gene Name DPP4
Gene ID 1803
Regulator Type Protein coding
Uniprot ID P27487
Sequence
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

    Click to Show/Hide
Family Peptidase S9B family
Function
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T- cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones such as brain natriuretic peptide 32. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.; (Microbial infection) Acts as a receptor for human coronavirus MERS-CoV-2.

    Click to Show/Hide
HGNC ID
HGNC:3009
KEGG ID hsa:1803
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DPP4 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell cycle
In Vitro Model
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
A-498 cells Renal cell carcinoma Homo sapiens CVCL_1056
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Female SCID mice (4-6 weeks old) were purchased and used for the xenograft models. Approximately 5 x 106 ccRCC cells were injected subcutaneously into the flank. The mice were treated with vehicle (control) or chaetocin (0.5 mg/kg/day) by daily intraperitoneal injection.

    Click to Show/Hide
Response regulation SUV39H1 expression is frequently upregulated in clear cell renal cell carcinoma (ccRCC) tumors and is significantly correlated with ccRCC progression. Function loss of SUV39H1 in ccRCC tumors contributes the hypomethylation of the DPP4 promoter to upregulate DPP4 expression and induces DPP4-mediated ferroptosis to suppress cell proliferation.
Hereditary Leiomyomatosis [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Dipeptidyl peptidase 4 (DPP4) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell cycle
In Vitro Model
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
Caki-1 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0234
A-498 cells Renal cell carcinoma Homo sapiens CVCL_1056
769-P cells Renal cell carcinom Homo sapiens CVCL_1050
ACHN cells Papillary renal cell carcinoma Homo sapiens CVCL_1067
HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Female SCID mice (4-6 weeks old) were purchased and used for the xenograft models. Approximately 5 x 106 ccRCC cells were injected subcutaneously into the flank. The mice were treated with vehicle (control) or chaetocin (0.5 mg/kg/day) by daily intraperitoneal injection.

    Click to Show/Hide
Response regulation SUV39H1 expression is frequently upregulated in clear cell renal cell carcinoma (ccRCC) tumors and is significantly correlated with ccRCC progression. Function loss of SUV39H1 in ccRCC tumors contributes the hypomethylation of the DPP4 promoter to upregulate DPP4 expression and induces DPP4-mediated ferroptosis to suppress cell proliferation.
References
Ref 1 SUV39H1 deficiency suppresses clear cell renal cell carcinoma growth by inducing ferroptosis. Acta Pharm Sin B. 2021 Feb;11(2):406-419. doi: 10.1016/j.apsb.2020.09.015. Epub 2020 Sep 30.