Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10451)
Regulator Name Semaphorin-3F (SEMA3F)
Synonyms
Sema III/F; Semaphorin IV
    Click to Show/Hide
Gene Name SEMA3F
Gene ID 6405
Regulator Type Protein coding
Uniprot ID Q13275
Sequence
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTIAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT

    Click to Show/Hide
Family Semaphorin family
Function
May play a role in cell motility and cell adhesion.

    Click to Show/Hide
HGNC ID
HGNC:10728
KEGG ID hsa:6405
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SEMA3F can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Glioblastoma ICD-11: 2A00
 Disease Info 
Responsed Drug Boric Acid Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 C6 cells Malignant glioma Rattus norvegicus CVCL_0194
Response regulation Our hypothesis and results provided proof that boric acid prevent tumor progression by regulation of ferroptosis, apoptosis and semaphorin signaling pathway. BA was found to have more effective on SEMA3F/NP2 upregulated against C6 untreated cells. What's more, the novel anticancer candidate drug effect of BA were principally associated with the ACSL4/GPX4, TOS/TAS biochemical marker and SEMA3F/NP2 signaling pathways. Dose-decently BA induced oxidative and ferroptosis in Glioblastoma multiform.
Glioblastoma [ICD-11: 2A00]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Semaphorin-3F (SEMA3F) Protein coding
 Regulator Info 
Responsed Drug Boric Acid Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 C6 cells Malignant glioma Rattus norvegicus CVCL_0194
Response regulation Our hypothesis and results provided proof that boric acid prevent tumor progression by regulation of ferroptosis, apoptosis and semaphorin signaling pathway. BA was found to have more effective on SEMA3F/NP2 upregulated against C6 untreated cells. What's more, the novel anticancer candidate drug effect of BA were principally associated with the ACSL4/GPX4, TOS/TAS biochemical marker and SEMA3F/NP2 signaling pathways. Dose-decently BA induced oxidative and ferroptosis in Glioblastoma multiform.
Boric Acid [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Glioblastoma ICD-11: 2A00
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell apoptosis
In Vitro Model
 C6 cells Malignant glioma Rattus norvegicus CVCL_0194
Response regulation Our hypothesis and results provided proof that boric acid prevent tumor progression by regulation of ferroptosis, apoptosis and semaphorin signaling pathway. BA was found to have more effective on SEMA3F/NP2 upregulated against C6 untreated cells. What's more, the novel anticancer candidate drug effect of BA were principally associated with the ACSL4/GPX4, TOS/TAS biochemical marker and SEMA3F/NP2 signaling pathways. Dose-decently BA induced oxidative and ferroptosis in Glioblastoma multiform.
References
Ref 1 The dual role of boron in vitro neurotoxication of glioblastoma cells via SEMA3F/NRP2 and ferroptosis signaling pathways. Environ Toxicol. 2023 Jan;38(1):70-77. doi: 10.1002/tox.23662. Epub 2022 Sep 22.