Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10446)
Regulator Name LIM and SH3 domain protein 1 (LASP1)
Synonyms
MLN50; Metastatic lymph node gene 50 protein
    Click to Show/Hide
Gene Name LASP1
Gene ID 3927
Regulator Type Protein coding
Uniprot ID Q14847
Sequence
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI
KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA
QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM
YGTVERTGDTGMLPANYVEAI

    Click to Show/Hide
Function
Plays an important role in the regulation of dynamic actin- based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).

    Click to Show/Hide
HGNC ID
HGNC:6513
KEGG ID hsa:3927
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
LASP1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Thyroid cancer ICD-11: 2D10
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Nthy-ori3-1 cells Normal Homo sapiens CVCL_2659
IHH-4 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_2960
BCPAP cells Thyroid carcinoma Homo sapiens CVCL_0153
KTC-1 cells Thyroid carcinoma Homo sapiens CVCL_6300
TPC-1 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
In Vivo Model
Animal experiments were approved by ethics committee of Wuzhou Red Cross Hospital. The TPC-1 cells transfected with sh-CERS6-AS1 or sh-NC were made into cell suspension (2 x 106/ml) with PBS. Then nude mice were randomly divided into sh-CERS6-AS1 group (n = 6) and sh-NC group (n = 6). The mice were subcutaneously inoculated with 200 ul corresponding cell suspension respectively, and then the weight and tumor volume of mice were recorded every other week. After 5 weeks, pentobarbital sodium (120 mg/kg) were intraperitoneally injected to make nude mice euthanasia, and then the tumors were stripped and weighed. Subsequently, immunohistochemistry and RT-PCR were performed.

    Click to Show/Hide
Response regulation Silencing CERS6-AS1 suppressed cell viability and increased ferroptosis in papillary thyroid cancer. LASP1 was modulated by CERS6-AS1 through sponging miR-497-5p. The expression of Ki67, PCNA, GPX4, and SLC7A11 was inhibited by si-CERS6-AS1 transfection.
Thyroid cancer [ICD-11: 2D10]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator LIM and SH3 domain protein 1 (LASP1) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 Nthy-ori3-1 cells Normal Homo sapiens CVCL_2659
IHH-4 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_2960
BCPAP cells Thyroid carcinoma Homo sapiens CVCL_0153
KTC-1 cells Thyroid carcinoma Homo sapiens CVCL_6300
TPC-1 cells Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
In Vivo Model
Animal experiments were approved by ethics committee of Wuzhou Red Cross Hospital. The TPC-1 cells transfected with sh-CERS6-AS1 or sh-NC were made into cell suspension (2 x 106/ml) with PBS. Then nude mice were randomly divided into sh-CERS6-AS1 group (n = 6) and sh-NC group (n = 6). The mice were subcutaneously inoculated with 200 ul corresponding cell suspension respectively, and then the weight and tumor volume of mice were recorded every other week. After 5 weeks, pentobarbital sodium (120 mg/kg) were intraperitoneally injected to make nude mice euthanasia, and then the tumors were stripped and weighed. Subsequently, immunohistochemistry and RT-PCR were performed.

    Click to Show/Hide
Response regulation Silencing CERS6-AS1 suppressed cell viability and increased ferroptosis in papillary thyroid cancer. LASP1 was modulated by CERS6-AS1 through sponging miR-497-5p. The expression of Ki67, PCNA, GPX4, and SLC7A11 was inhibited by si-CERS6-AS1 transfection.
References
Ref 1 CERS6-AS1 Facilitates Oncogenesis and Restrains Ferroptosis in Papillary Thyroid Carcinoma by Serving as a ceRNA through miR-497-5p/LASP1 Axis. Ann Clin Lab Sci. 2022 May;52(3):426-438.