Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10417)
Regulator Name Thioredoxin reductase 2, mitochondrial (TXNRD2)
Synonyms
Selenoprotein Z; TR-beta; Thioredoxin reductase TR3
    Click to Show/Hide
Gene Name TXNRD2
Gene ID 10587
Regulator Type Protein coding
Uniprot ID Q9NNW7
Sequence
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQ
LGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQP
VPHDWRKMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVCGVAKGGKEILLS
ADHIIIATGGRPRYPTHIEGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGI
GLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCAPSRVRRLPDGQLQVTWEDST
TGKEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPDTQKILVDSREATSVPHIYAIGDV
VEGRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
QEHVEVYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALG
IKCGASYAQVMRTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG

    Click to Show/Hide
Family Class-I pyridine nucleotide-disulfide oxidoreductase family
Function
Involved in the control of reactive oxygen species levels and the regulation of mitochondrial redox homeostasis. Maintains thioredoxin in a reduced state. May play a role in redox- regulated cell signaling.

    Click to Show/Hide
HGNC ID
HGNC:18155
KEGG ID hsa:10587
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TXNRD2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hemochromatosis ICD-11: 3B10-3B11
 Disease Info 
Responsed Drug Auranofin Investigative
 Drug Info 
Pathway Response JAK-STAT signaling pathway hsa04630
NF-kappa B signaling pathway hsa04064
Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
C57BL/6J mice (7-8 weeks of age, both males and females) were purchased from Vital River Laboratory Animal Technology Co., Ltd., Beijing, China. Hfe-/-mice were kindly provided by Dr. Nancy C. Andrews. All mice were housed in a specific pathogen-free facility and fed an egg white-based AIN-76A diet containing 50 mg/kg iron (Research Diets, Inc., New Brunswick, NJ).

    Click to Show/Hide
Response regulation High-dose auranofin (AUR) induces ferroptosis and causes lipid peroxidation through inhibition of thioredoxin reductase (TXNRD) activity.In conclusion, TXNRD is a key regulator of ferroptosis, and AUR is a novel activator of hepcidin and ferroptosis via distinct mechanisms, suggesting a promising approach for treating hemochromatosis and hepcidin-deficiency related disorders.
Hemochromatosis [ICD-11: 3B10-3B11]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Thioredoxin reductase 2, mitochondrial (TXNRD2) Protein coding
 Regulator Info 
Responsed Drug Auranofin Investigative
 Drug Info 
Pathway Response JAK-STAT signaling pathway hsa04630
NF-kappa B signaling pathway hsa04064
Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
C57BL/6J mice (7-8 weeks of age, both males and females) were purchased from Vital River Laboratory Animal Technology Co., Ltd., Beijing, China. Hfe-/-mice were kindly provided by Dr. Nancy C. Andrews. All mice were housed in a specific pathogen-free facility and fed an egg white-based AIN-76A diet containing 50 mg/kg iron (Research Diets, Inc., New Brunswick, NJ).

    Click to Show/Hide
Response regulation High-dose auranofin (AUR) induces ferroptosis and causes lipid peroxidation through inhibition of thioredoxin reductase (TXNRD) activity.In conclusion, TXNRD is a key regulator of ferroptosis, and AUR is a novel activator of hepcidin and ferroptosis via distinct mechanisms, suggesting a promising approach for treating hemochromatosis and hepcidin-deficiency related disorders.
Auranofin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Hemochromatosis ICD-11: 3B10-3B11
 Disease Info 
Pathway Response JAK-STAT signaling pathway hsa04630
NF-kappa B signaling pathway hsa04064
Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
C57BL/6J mice (7-8 weeks of age, both males and females) were purchased from Vital River Laboratory Animal Technology Co., Ltd., Beijing, China. Hfe-/-mice were kindly provided by Dr. Nancy C. Andrews. All mice were housed in a specific pathogen-free facility and fed an egg white-based AIN-76A diet containing 50 mg/kg iron (Research Diets, Inc., New Brunswick, NJ).

    Click to Show/Hide
Response regulation High-dose auranofin (AUR) induces ferroptosis and causes lipid peroxidation through inhibition of thioredoxin reductase (TXNRD) activity.In conclusion, TXNRD is a key regulator of ferroptosis, and AUR is a novel activator of hepcidin and ferroptosis via distinct mechanisms, suggesting a promising approach for treating hemochromatosis and hepcidin-deficiency related disorders.
References
Ref 1 Auranofin mitigates systemic iron overload and induces ferroptosis via distinct mechanisms. Signal Transduct Target Ther. 2020 Jul 31;5(1):138. doi: 10.1038/s41392-020-00253-0.