Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10411)
Regulator Name E3 ubiquitin-protein ligase ZNRF3 (ZNRF3)
Synonyms
KIAA1133; RNF203; RING finger protein 203; RING-type E3 ubiquitin transferase ZNRF3; Zinc/RING finger protein 3
    Click to Show/Hide
Gene Name ZNRF3
Regulator Type Protein coding
Uniprot ID Q9ULT6
Sequence
MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAF
VEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGW
VGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPV
VYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKI
KLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSSSTSDCAICLEKY
IDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVETSNLSRGRQQ
RVTLPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVTLLTMDRHGEQSLYSPQTPAYIRSYP
PLHLDHSLAAHRCGLEHRAYSPAHPFRRPKLSGRSFSKAACFSQYETMYQHYYFQGLSYP
EQEGQSPPSLAPRGPARAFPPSGSGSLLFPTVVHVAPPSHLESGSTSSFSCYHGHRSVCS
GYLADCPGSDSSSSSSSGQCHCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYR
SRSPCRASEAGGSGSSGRGPALCFEGSPPPEELPAVHSHGAGRGEPWPGPASPSGDQVST
CSLEMNYSSNSSLEHRGPNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSP
AGPSAGAAGSSTLFLGPHLYEGSGPAGGEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCC
FYEEKQVARGGGGGSGCYTEDYSVSVQYTLTEEPPPGCYPGARDLSQRIPIIPEDVDCDL
GLPSDCQGTHSLGSWGGTRGPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAV
RANFPSALQDTQESSTTATEAAGPRSHSADSSSPGA

    Click to Show/Hide
Family ZNRF3 family
Function
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby restricting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification (By similarity).

    Click to Show/Hide
HGNC ID
HGNC:18126
KEGG ID hsa:84133
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ZNRF3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
KATO III cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0371
MKN-1 cells Gastric carcinoma Homo sapiens CVCL_1415
HGC-27 cells Gastric carcinoma Homo sapiens CVCL_1279
In Vivo Model
Nude mice (5-week old; Shanghai SLAC Laboratory Animals, Shanghai, China) were arbitrarily divided into two groups (n = 5). AGS cells (1 x 106 ) stably expressing circ_0000190 were inoculated into the flank of the nude mice. Tumor volume was monitored every 4 d with the method of (length x width2 )/2. These mice were euthanized after 28-d inoculation.

    Click to Show/Hide
Response regulation Circ_0000190 overexpression inhibited the proliferation, migration and invasion and promoted Erastin- or ras selective lethal 3 (RSL3)-mediated ferroptosis in gastric cancer cells. And circ_0000190 suppressed GC progression via miR-382-5p-dependent regulation of ZNRF3.
Gastric cancer [ICD-11: 2B72]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator E3 ubiquitin-protein ligase ZNRF3 (ZNRF3) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
KATO III cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0371
MKN-1 cells Gastric carcinoma Homo sapiens CVCL_1415
HGC-27 cells Gastric carcinoma Homo sapiens CVCL_1279
In Vivo Model
Nude mice (5-week old; Shanghai SLAC Laboratory Animals, Shanghai, China) were arbitrarily divided into two groups (n = 5). AGS cells (1 x 106 ) stably expressing circ_0000190 were inoculated into the flank of the nude mice. Tumor volume was monitored every 4 d with the method of (length x width2 )/2. These mice were euthanized after 28-d inoculation.

    Click to Show/Hide
Response regulation Circ_0000190 overexpression inhibited the proliferation, migration and invasion and promoted Erastin- or ras selective lethal 3 (RSL3)-mediated ferroptosis in gastric cancer cells. And circ_0000190 suppressed GC progression via miR-382-5p-dependent regulation of ZNRF3.
References
Ref 1 Circ_0000190 sponges miR-382-5p to suppress cell proliferation and motility and promote cell death by targeting ZNRF3 in gastric cancer. J Biochem. 2022 Jan 14:mvac003. doi: 10.1093/jb/mvac003. Online ahead of print.