General Information of the Ferroptosis Regulator (ID: REG10361)
Regulator Name Elongation of very long chain fatty acids protein 5 (ELOVL5)
Synonyms
ELOVL2; 3-keto acyl-CoA synthase ELOVL5
    Click to Show/Hide
Gene Name ELOVL5
Gene ID 60481
Regulator Type Protein coding
Uniprot ID Q9NYP7
Sequence
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSK
LIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM
YSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMI
SLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

    Click to Show/Hide
Family ELO family
Function
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. In conditions where the essential linoleic and alpha linoleic fatty acids are lacking it is also involved in the synthesis of Mead acid from oleic acid.

    Click to Show/Hide
HGNC ID
HGNC:21308
KEGG ID hsa:60481
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
ELOVL5 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Gastric cancer ICD-11: 2B72
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN-28 cells Gastric epithelial carcinoma Homo sapiens CVCL_1416
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-N87 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SNU-484 cells Gastric adenocarcinoma Homo sapiens CVCL_0100
SNU-601 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0101
SNU-668 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_5081
SNU-719 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
YCC-6 cells Gastric adenocarcinoma Homo sapiens CVCL_9662
YCC-16 cells Gastric adenocarcinoma Homo sapiens CVCL_9649
Hs746T cells Gastric adenocarcinoma Homo sapiens CVCL_0333
Response regulation The expression of elongation of very long-chain fatty acid protein 5 (ELOVL5) and fatty acid desaturase 1 (FADS1) is up-regulated in mesenchymal-type gastric cancer cells (GCs), leading to ferroptosis sensitization.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Elongation of very long chain fatty acids protein 5 (ELOVL5) Protein coding
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
AGS cells Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN-28 cells Gastric epithelial carcinoma Homo sapiens CVCL_1416
MKN45 cells Gastric adenocarcinoma Homo sapiens CVCL_0434
NCI-N87 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SNU-484 cells Gastric adenocarcinoma Homo sapiens CVCL_0100
SNU-601 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_0101
SNU-668 cells Gastric signet ring cell adenocarcinoma Homo sapiens CVCL_5081
SNU-719 cells Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
YCC-6 cells Gastric adenocarcinoma Homo sapiens CVCL_9662
YCC-16 cells Gastric adenocarcinoma Homo sapiens CVCL_9649
Hs746T cells Gastric adenocarcinoma Homo sapiens CVCL_0333
Response regulation The expression of elongation of very long-chain fatty acid protein 5 (ELOVL5) and fatty acid desaturase 1 (FADS1) is up-regulated in mesenchymal-type gastric cancer cells (GCs), leading to ferroptosis sensitization.
References
Ref 1 Polyunsaturated fatty acid biosynthesis pathway determines ferroptosis sensitivity in gastric cancer. Proc Natl Acad Sci U S A. 2020 Dec 22;117(51):32433-32442. doi: 10.1073/pnas.2006828117. Epub 2020 Dec 7.