Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10356)
Regulator Name Lymphoid-specific helicase (HELLS)
Synonyms
Proliferation-associated SNF2-like protein; SWI/SNF2-related matrix-associated actin-dependent regulator of chromatin subfamily A member 6
    Click to Show/Hide
Gene Name HELLS
Gene ID 3070
Regulator Type Protein coding
Uniprot ID Q9NRZ9
Sequence
MPAERPAGSGGSEAPAMVEQLDTAVITPAMLEEEEQLEAAGLERERKMLEKARMSWDRES
TEIRYRRLQHLLEKSNIYSKFLLTKMEQQQLEEQKKKEKLERKKESLKVKKGKNSIDASE
EKPVMRKKRGREDESYNISEVMSKEEILSVAKKNKKENEDENSSSTNLCVEDLQKNKDSN
SIIKDRLSETVRQNTKFFFDPVRKCNGQPVPFQQPKHFTGGVMRWYQVEGMEWLRMLWEN
GINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPDIPTM
LYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAMRDRNALQHCYWKYLIVDEGHRIK
NMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSL
SETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFY
TAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVD
RERAVVEVNIPVESEVNLKLQNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGK
FLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHS
FNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVY
RLVTANTIDQKIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKELMELLKSRDY
EREIKGSREKVISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF

    Click to Show/Hide
Family SNF2/RAD54 helicase family
Function
Plays an essential role in normal development and survival. Involved in regulation of the expansion or survival of lymphoid cells. Required for de novo or maintenance DNA methylation. May control silencing of the imprinted CDKN1C gene through DNA methylation. May play a role in formation and organization of heterochromatin, implying a functional role in the regulation of transcription and mitosis.

    Click to Show/Hide
HGNC ID
HGNC:4861
KEGG ID hsa:3070
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
HELLS can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Stearoyl-CoA desaturase (SCD) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 MRC-5 cells Normal Homo sapiens CVCL_0440
HBE1 cells Normal Homo sapiens CVCL_0287
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
NCI-H522 cells Non-small cell lung carcinoma Homo sapiens CVCL_1567
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
95C cells Lung giant cell carcinoma Homo sapiens CVCL_7109
95D cells Lung giant cell carcinoma Homo sapiens CVCL_7110
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
SCID Mice (Hunan SJA Laboratory Animal Co.Ltd.) were injected with A549 (1 x 106 cells/mouse) or H358 (2 x 106 cells/mouse) cells via mammary fat pad (10 mice/group). Mice with A549 or H358 cells were imaged from dorsal and ventral views every three days.

    Click to Show/Hide
Response regulation LSH (HELLS) is involved in ferroptosis and is a potential therapeutic target in cancer because of its crucial role in ferroptosis. LSH functioned as an oncogene in lung cancer in vitro and in vivo. And LSH promotes the lipid metabolic genes, including SCD1 and FADS2.
Lung cancer [ICD-11: 2C25]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Lymphoid-specific helicase (HELLS) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 MRC-5 cells Normal Homo sapiens CVCL_0440
HBE1 cells Normal Homo sapiens CVCL_0287
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H358 cells Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
NCI-H522 cells Non-small cell lung carcinoma Homo sapiens CVCL_1567
PC-9 cells Lung adenocarcinoma Homo sapiens CVCL_B260
95C cells Lung giant cell carcinoma Homo sapiens CVCL_7109
95D cells Lung giant cell carcinoma Homo sapiens CVCL_7110
HEK-293T cells Normal Homo sapiens CVCL_0063
In Vivo Model
SCID Mice (Hunan SJA Laboratory Animal Co.Ltd.) were injected with A549 (1 x 106 cells/mouse) or H358 (2 x 106 cells/mouse) cells via mammary fat pad (10 mice/group). Mice with A549 or H358 cells were imaged from dorsal and ventral views every three days.

    Click to Show/Hide
Response regulation LSH (HELLS) is involved in ferroptosis and is a potential therapeutic target in cancer because of its crucial role in ferroptosis. LSH functioned as an oncogene in lung cancer in vitro and in vivo. And LSH promotes the lipid metabolic genes, including SCD1 and FADS2.
References
Ref 1 EGLN1/c-Myc Induced Lymphoid-Specific Helicase Inhibits Ferroptosis through Lipid Metabolic Gene Expression Changes. Theranostics. 2017 Jul 23;7(13):3293-3305. doi: 10.7150/thno.19988. eCollection 2017.