General Information of the Ferroptosis Regulator (ID: REG10346)
Regulator Name Prokineticin-2 (PROK2)
Synonyms
BV8; Protein Bv8 homolog
    Click to Show/Hide
Gene Name PROK2
Gene ID 60675
Regulator Type Protein coding
Uniprot ID Q9HC23
Sequence
MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTP
MGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSF
NRFICLAQK

    Click to Show/Hide
Family AVIT (prokineticin) family
Function
May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle.

    Click to Show/Hide
HGNC ID
HGNC:18455
KEGG ID hsa:60675
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PROK2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Long-chain-fatty-acid--CoA ligase 4 (ACSL4) [Driver]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Driver
Responsed Disease Traumatic brain injury ICD-11: NA07
Pathway Response Ubiquitin mediated proteolysis hsa04120
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
rPCNs (Rat primary cortical neurons)
hBCs (Brain cells)
In Vivo Model
Eight-week-old male mice were subjected to severe CCI. Anesthesia was induced with 3% isoflurane in nitrous oxide: oxygen (7:3) and maintained with 1.5% isoflurane via nose cone. Temperature was maintained at 37 ± 0.5 using a heating blanket. After anesthesia, mice were placed in a stereotaxic frame (R.W.D. Shenzhen, China). A 4-mm-diameter craniotomy was performed over the left parietal bone and the bone flap was removed for trauma. A vertically directed CCI was applied (6.0 ± 0.2 m/s, 50 ms dwell time, 1.4 mm depth) using an impactor (R.W.D., Shenzhen, China). After the injury, the skin incision was closed. Mice were monitored with supplemental oxygen (100%) for 1h before returning to their cages. Fer-1 (1 mg/kg per day) was given i.p. at 7 days before CCI and once daily until euthanasia or the MWM test. Before the brain tissues were obtained, mice were perfused intracardially with 4 phosphate-buffer saline (PBS) solution.

    Click to Show/Hide
Response regulation Prok2 mediates neuronal cell deaths in traumatic brain injury via ferroptosis. Prok2 prevents neuronal cell death by suppressing the biosynthesis of lipid peroxidation substrates, arachidonic acid-phospholipids, via accelerated F-box only protein 10 (Fbxo10)-driven ubiquitination, degradation of long-chain-fatty-acid-CoA ligase 4 (Acsl4), and inhibition of lipid peroxidation.
Traumatic brain injury [ICD-11: NA07]
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Prokineticin-2 (PROK2) Protein coding
Pathway Response Ubiquitin mediated proteolysis hsa04120
Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
In Vitro Model
rPCNs (Rat primary cortical neurons)
hBCs (Brain cells)
In Vivo Model
Eight-week-old male mice were subjected to severe CCI. Anesthesia was induced with 3% isoflurane in nitrous oxide: oxygen (7:3) and maintained with 1.5% isoflurane via nose cone. Temperature was maintained at 37 ± 0.5 using a heating blanket. After anesthesia, mice were placed in a stereotaxic frame (R.W.D. Shenzhen, China). A 4-mm-diameter craniotomy was performed over the left parietal bone and the bone flap was removed for trauma. A vertically directed CCI was applied (6.0 ± 0.2 m/s, 50 ms dwell time, 1.4 mm depth) using an impactor (R.W.D., Shenzhen, China). After the injury, the skin incision was closed. Mice were monitored with supplemental oxygen (100%) for 1h before returning to their cages. Fer-1 (1 mg/kg per day) was given i.p. at 7 days before CCI and once daily until euthanasia or the MWM test. Before the brain tissues were obtained, mice were perfused intracardially with 4 phosphate-buffer saline (PBS) solution.

    Click to Show/Hide
Response regulation Prok2 mediates neuronal cell deaths in traumatic brain injury via ferroptosis. Prok2 prevents neuronal cell death by suppressing the biosynthesis of lipid peroxidation substrates, arachidonic acid-phospholipids, via accelerated F-box only protein 10 (Fbxo10)-driven ubiquitination, degradation of long-chain-fatty-acid-CoA ligase 4 (Acsl4), and inhibition of lipid peroxidation.
References
Ref 1 Prokineticin-2 prevents neuronal cell deaths in a model of traumatic brain injury. Nat Commun. 2021 Jul 9;12(1):4220. doi: 10.1038/s41467-021-24469-y.