Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10342)
Regulator Name 5'-nucleotidase domain-containing protein 2 (NT5DC2)
Gene Name NT5DC2
Gene ID 64943
Regulator Type Protein coding
Uniprot ID Q9H857
Sequence
MRVESGSAQERGILLESLSTLLEKTTASHEGRAPGNRELTDLLPPEVCSLLNPAAIYANN
EISLRDVEVYGFDYDYTLAQYADALHPEIFSTARDILIEHYKYPEGIRKYDYNPSFAIRG
LHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEVIELYGGTQHIPLYQMSGFYGKGPS
IKQFMDIFSLPEMALLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDM
EKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMRHMVGPDWRQLFDVVIVQADK
PSFFTDRRKPFRKLDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHL
YSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESR
QVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYR
VDFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

    Click to Show/Hide
Family 5'(3')-deoxyribonucleotidase family
HGNC ID
HGNC:25717
KEGG ID hsa:64943
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
NT5DC2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Fibrosarcoma ICD-11: 2B53
 Disease Info 
Responsed Drug FIPC-1 Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A-375 cells Amelanotic melanoma Homo sapiens CVCL_0132
Response regulation Iron-dependent and competitive protein labeling by FIPC-1 was demonstrated in a quantitative chemoproteomic workflow that identified several saturable protein targets in fibrosarcoma cells, including P4HB and NT5DC2.
Fibrosarcoma [ICD-11: 2B53]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator 5'-nucleotidase domain-containing protein 2 (NT5DC2) Protein coding
 Regulator Info 
Responsed Drug FIPC-1 Investigative
 Drug Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A-375 cells Amelanotic melanoma Homo sapiens CVCL_0132
Response regulation Iron-dependent and competitive protein labeling by FIPC-1 was demonstrated in a quantitative chemoproteomic workflow that identified several saturable protein targets in fibrosarcoma cells, including P4HB and NT5DC2.
FIPC-1 [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Fibrosarcoma ICD-11: 2B53
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A-375 cells Amelanotic melanoma Homo sapiens CVCL_0132
Response regulation Iron-dependent and competitive protein labeling by FIPC-1 was demonstrated in a quantitative chemoproteomic workflow that identified several saturable protein targets in fibrosarcoma cells, including P4HB and NT5DC2.
References
Ref 1 Reactivity-Based Probe of the Iron(II)-Dependent Interactome Identifies New Cellular Modulators of Ferroptosis. J Am Chem Soc. 2020 Nov 11;142(45):19085-19093. doi: 10.1021/jacs.0c06709. Epub 2020 Oct 30.