Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10319)
Regulator Name Tyrosine-protein phosphatase non-receptor type 18 (PTPN18)
Synonyms
BDP1; Brain-derived phosphatase
    Click to Show/Hide
Gene Name PTPN18
Gene ID 26469
Regulator Type Protein coding
Uniprot ID Q99952
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKN
RYKDVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKR
GAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV

    Click to Show/Hide
Family Protein-tyrosine phosphatase family
Function
Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.

    Click to Show/Hide
HGNC ID
HGNC:9649
KEGG ID hsa:26469
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PTPN18 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Corpus uteri cancer ICD-11: 2C76
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 KLE cells Endometrial adenocarcinoma Homo sapiens CVCL_1329
Response regulation Silencing of PTPN18 induced ferroptosis in KLE endometrial cancer cells. PTPN18 knockdown increased intracellular ROS level and down-regulated GPX4 and xCT expression. Besides, silencing of PTPN18 also induced the expression of p-p38 (MAPK14).
Corpus uteri cancer [ICD-11: 2C76]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Tyrosine-protein phosphatase non-receptor type 18 (PTPN18) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 KLE cells Endometrial adenocarcinoma Homo sapiens CVCL_1329
Response regulation Silencing of PTPN18 induced ferroptosis in KLE endometrial cancer cells. PTPN18 knockdown increased intracellular ROS level and down-regulated GPX4 and xCT expression. Besides, silencing of PTPN18 also induced the expression of p-p38 (MAPK14).
References
Ref 1 Silencing of PTPN18 Induced Ferroptosis in Endometrial Cancer Cells Through p-P38-Mediated GPX4/xCT Down-Regulation. Cancer Manag Res. 2021 Feb 19;13:1757-1765. doi: 10.2147/CMAR.S278728. eCollection 2021.