Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10315)
Regulator Name Cell division cycle-associated protein 3 (CDCA3)
Synonyms
C8, GRCC8, TOME1; Gene-rich cluster protein C8; Trigger of mitotic entry protein 1
    Click to Show/Hide
Gene Name CDCA3
Gene ID 83461
Regulator Type Protein coding
Uniprot ID Q99618
Sequence
MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKH
AQDSDPRSPTLGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSS
ELDLPLGTQLSVEEQMPPWNQTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRS
SGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTG
RLLKTGGRAWEQGQDHDKENQHFPLVES

    Click to Show/Hide
Function
F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase.

    Click to Show/Hide
HGNC ID
HGNC:14624
KEGG ID hsa:83461
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CDCA3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Response regulation ACADSB and MYCN are the favorable prognostic marker of clear cell renal cell carcinoma (ccRCC), while CDCA3, CHAC1, and TFAP2A are the unfavorable prognostic marker of ccRCC.
Hereditary Leiomyomatosis [ICD-11: 2C90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Cell division cycle-associated protein 3 (CDCA3) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Cell Process Cell ferroptosis
Response regulation ACADSB and MYCN are the favorable prognostic marker of clear cell renal cell carcinoma (ccRCC), while CDCA3, CHAC1, and TFAP2A are the unfavorable prognostic marker of ccRCC.
References
Ref 1 Exploring a ferroptosis and oxidative stress-based prognostic model for clear cell renal cell carcinoma. Front Oncol. 2023 Mar 30;13:1131473. doi: 10.3389/fonc.2023.1131473. eCollection 2023.