Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10307)
Regulator Name Pannexin-2 (PANX2)
Gene Name PANX2
Gene ID 56666
Regulator Type Protein coding
Uniprot ID Q96RD6
Sequence
MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVL
VPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFE
HKFLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQI
QSKGPGITEREKREIIENAEKEKSPEQNLFEKYLERRGRSNFLAKLYLARHVLILLLSAV
PISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCKLPSVQLQRIIAGVDIVLLCV
MNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKS
LNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP
PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRS
AHHYKGGGGDPGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASR
SQEGGFLSQAEDCGLGLAPAPIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAV
APLTPASLGKAEPLTILSRNATHPLLHINTLYEAREEEDGGPRLPQDVGDLIAIPAPQQI
LIATFDEPRTVVSTVEF

    Click to Show/Hide
Family Pannexin family
Function
Structural component of the gap junctions and the hemichannels.

    Click to Show/Hide
HGNC ID
HGNC:8600
KEGG ID hsa:56666
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PANX2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Prostate cancer ICD-11: 2C82
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 LNCaP cells Prostate carcinoma Homo sapiens CVCL_0395
PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
DU145 cells Prostate carcinoma Homo sapiens CVCL_0105
RWPE-1 cells Normal Homo sapiens CVCL_3791
Response regulation PANX2 is implicated in the pathogenesis of prostate cancer (PCa), which regulates malignant phenotypes and ferroptosis through Nrf2 signaling pathway (Nrf2, HO-1, and FTH1), and maybe a potential therapeutic target for PCa. Blocking expression of PANX2 resulted in suppression of proliferation, migration, and invasion in PCa cells, while increasing ferrous iron and MDA levels.
Prostate cancer [ICD-11: 2C82]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Pannexin-2 (PANX2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 LNCaP cells Prostate carcinoma Homo sapiens CVCL_0395
PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
DU145 cells Prostate carcinoma Homo sapiens CVCL_0105
RWPE-1 cells Normal Homo sapiens CVCL_3791
Response regulation PANX2 is implicated in the pathogenesis of prostate cancer (PCa), which regulates malignant phenotypes and ferroptosis through Nrf2 signaling pathway (Nrf2, HO-1, and FTH1), and maybe a potential therapeutic target for PCa. Blocking expression of PANX2 resulted in suppression of proliferation, migration, and invasion in PCa cells, while increasing ferrous iron and MDA levels.
References
Ref 1 Identification of Pannexin 2 as a Novel Marker Correlating with Ferroptosis and Malignant Phenotypes of Prostate Cancer Cells. Onco Targets Ther. 2020 May 19;13:4411-4421. doi: 10.2147/OTT.S249752. eCollection 2020.