Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10300)
Regulator Name DAZ-associated protein 1 (DAZAP1)
Synonyms
Deleted in azoospermia-associated protein 1
    Click to Show/Hide
Gene Name DAZAP1
Gene ID 26528
Regulator Type Protein coding
Uniprot ID Q96EP5
Sequence
MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKD
PNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGI
PHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMG
KKVEVKRAEPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAG
QAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPP
PDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFG
QGFSDPSQQPPSYGGPSVPGSGGPPAGGSGFGRGQNHNVQGFHPYRR

    Click to Show/Hide
Function
RNA-binding protein, which may be required during spermatogenesis.

    Click to Show/Hide
HGNC ID
HGNC:2683
KEGG ID hsa:26528
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
DAZAP1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Male BALB/c nude mice (4-5 weeks, 14-18 g) were purchased from Vital River Laboratories (Beijing, China). We randomly (random number grouping method) divided the mice into five groups: the blank group, the DMSO group, the SF group, the SF + sh-NC group and the SF + sh-DAZAP1 group. For SF-intervention mice, we dissolved 10 mg/kg of SF into 0.2 ml DMSO and injected the mixture intraperitoneally every other day for two weeks. 1 x 107 cells (with or without lentivirus) suspended in 500 ul of ice-cold PBS were subcutaneously injected into the left flank of mice.

    Click to Show/Hide
Response regulation DAZAP1 knockdown by small interfering RNA markedly inhibited hepatocellular carcinoma (HCC) cell proliferation, migration and invasion. At the mechanistic level, DAZAP1 was identified as a potent inhibitor of ferroptosis and an efficient binding partner of SLC7A11 mRNA.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator DAZ-associated protein 1 (DAZAP1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
Hep 3B2.1-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0326
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
Huh-7 cells Hepatocellular carcinoma Homo sapiens CVCL_0336
L-02 cells Endocervical adenocarcinoma Homo sapiens CVCL_6926
In Vivo Model
Male BALB/c nude mice (4-5 weeks, 14-18 g) were purchased from Vital River Laboratories (Beijing, China). We randomly (random number grouping method) divided the mice into five groups: the blank group, the DMSO group, the SF group, the SF + sh-NC group and the SF + sh-DAZAP1 group. For SF-intervention mice, we dissolved 10 mg/kg of SF into 0.2 ml DMSO and injected the mixture intraperitoneally every other day for two weeks. 1 x 107 cells (with or without lentivirus) suspended in 500 ul of ice-cold PBS were subcutaneously injected into the left flank of mice.

    Click to Show/Hide
Response regulation DAZAP1 knockdown by small interfering RNA markedly inhibited hepatocellular carcinoma (HCC) cell proliferation, migration and invasion. At the mechanistic level, DAZAP1 was identified as a potent inhibitor of ferroptosis and an efficient binding partner of SLC7A11 mRNA.
References
Ref 1 RNA binding protein DAZAP1 promotes HCC progression and regulates ferroptosis by interacting with SLC7A11 mRNA. Exp Cell Res. 2021 Feb 1;399(1):112453. doi: 10.1016/j.yexcr.2020.112453. Epub 2020 Dec 29.