Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10292)
Regulator Name Transcription factor AP-2 gamma (TFAP2C)
Synonyms
Activating enhancer-binding protein 2 gamma; Transcription factor ERF-1
    Click to Show/Hide
Gene Name TFAP2C
Gene ID 7022
Regulator Type Protein coding
Uniprot ID Q92754
Sequence
MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYF
PPPYQQLAYSQSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGR
PAGLLPHLSGLEAGAVSARRDAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNV
DDQHLLLHDQTVIRKGPISMTKNPLNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKY
KVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVT
LLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKNMLLAAQQLCK
EFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEAL
IVIDKSYMNPGDQSPADSNKTLEKMEKHRK

    Click to Show/Hide
Family AP-2 family
Function
Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.

    Click to Show/Hide
HGNC ID
HGNC:11744
KEGG ID hsa:7022
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TFAP2C can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Prostate cancer ICD-11: 2C82
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 cells Prostate carcinoma Homo sapiens CVCL_1045
In Vivo Model
PC3 and PC3/DR cells (5 x 106 cells) were subcutaneously injected into each flank of six-week-old male BALB/c nude mice (HFK Biotech, China). When the tumor volume reached 100 mm3, the mice were treated with Dimethyl Sulfoxide (DMSO) alone, DTX (5 mg/kg body weight, every two days) with DMSO or erastin (20 mg/kg body weight in 20 ul DMSO plus 130 ul corn oil, daily) by intraperitoneal injection.

    Click to Show/Hide
Response regulation Docetaxel (DTX)-resistant prostate cancer cells develop tolerance toward ferroptosis and that lncRNAPCAT1 promotes chemoresistance by blocking DTX-induced ferroptosis. Mechanistic studies indicated that PCAT1 activates the expression of SLC7A11 by interacting with c-Myc and sponging with miR-25-3p. In addition, TFAP2C activates PCAT1 expression to reduce ferroptosis susceptibility and enhance chemoresistance.
Prostate cancer [ICD-11: 2C82]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Transcription factor AP-2 gamma (TFAP2C) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 cells Prostate carcinoma Homo sapiens CVCL_1045
In Vivo Model
PC3 and PC3/DR cells (5 x 106 cells) were subcutaneously injected into each flank of six-week-old male BALB/c nude mice (HFK Biotech, China). When the tumor volume reached 100 mm3, the mice were treated with Dimethyl Sulfoxide (DMSO) alone, DTX (5 mg/kg body weight, every two days) with DMSO or erastin (20 mg/kg body weight in 20 ul DMSO plus 130 ul corn oil, daily) by intraperitoneal injection.

    Click to Show/Hide
Response regulation Docetaxel (DTX)-resistant prostate cancer cells develop tolerance toward ferroptosis and that lncRNAPCAT1 promotes chemoresistance by blocking DTX-induced ferroptosis. Mechanistic studies indicated that PCAT1 activates the expression of SLC7A11 by interacting with c-Myc and sponging with miR-25-3p. In addition, TFAP2C activates PCAT1 expression to reduce ferroptosis susceptibility and enhance chemoresistance.
References
Ref 1 TFAP2C-Mediated lncRNA PCAT1 Inhibits Ferroptosis in Docetaxel-Resistant Prostate Cancer Through c-Myc/miR-25-3p/SLC7A11 Signaling. Front Oncol. 2022 Mar 23;12:862015. doi: 10.3389/fonc.2022.862015. eCollection 2022.