Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10289)
Regulator Name Tribbles homolog 2 (TRIB2)
Gene Name TRIB2
Gene ID 28951
Regulator Type Protein coding
Uniprot ID Q92519
Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSC
IGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEII
LGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRK
FIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSL
GVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQ
EILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

    Click to Show/Hide
Family CAMK Ser/Thr protein kinase family
Function
Interacts with MAPK kinases and regulates activation of MAP kinases. Does not display kinase activity.

    Click to Show/Hide
HGNC ID
HGNC:30809
KEGG ID hsa:28951
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TRIB2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Transferrin receptor protein 1 (TFRC) [Driver; Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor/Driver
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 BEL-7404 cells Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation The effects by which TrCP-mediated ubiquitination and followed degradation of TFRC to decline labile iron are critical for TRIB2 to desensitize liver cancer cells to ferroptosis. Appropriate reduction of TRIB2 function might be beneficial for patients bearing liver cancer because it will definitely sensitize ferroptosis-based therapy.
Hepatocellular carcinoma [ICD-11: 2C12]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Tribbles homolog 2 (TRIB2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 BEL-7404 cells Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 cells Endocervical adenocarcinoma Homo sapiens CVCL_5492
SMMC-7721 cells Endocervical adenocarcinoma Homo sapiens CVCL_0534
SK-HEP-1 cells Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Hep-G2 cells Hepatoblastoma Homo sapiens CVCL_0027
HEK-293T cells Normal Homo sapiens CVCL_0063
Response regulation The effects by which TrCP-mediated ubiquitination and followed degradation of TFRC to decline labile iron are critical for TRIB2 to desensitize liver cancer cells to ferroptosis. Appropriate reduction of TRIB2 function might be beneficial for patients bearing liver cancer because it will definitely sensitize ferroptosis-based therapy.
References
Ref 1 TRIB2 desensitizes ferroptosis via TrCP-mediated TFRC ubiquitiantion in liver cancer cells. Cell Death Discov. 2021 Jul 27;7(1):196. doi: 10.1038/s41420-021-00574-1.