Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10281)
Regulator Name Protein FAM98A (FAM98A)
Gene Name FAM98A
Gene ID 25940
Regulator Type Protein coding
Uniprot ID Q8NCA5
Sequence
MECDLMETDILESLEDLGYKGPLLEDGALSQAVSAGASSPEFTKLCAWLVSELRVLCKLE
ENVQATNSPSEAEEFQLEVSGLLGEMNCPYLSLTSGDVTKRLLIQKNCLLLLTYLISELE
AARMLCVNAPPKKAQEGGGSEVFQELKGICIALGMSKPPANITMFQFFSGIEKKLKETLA
KVPPNHVGKPLLKKPMGPAHWEKIEAINQAIANEYEVRRKLLIKRLDVTVQSFGWSDRAK
SQTEKLAKVYQPKRSVLSPKTTISVAHLLAARQDLSKILRTSSGSIREKTACAINKVLMG
RVPDRGGRPNEIEPPPPEMPPWQKRQDGPQQQTGGRGGGRGGYEHSSYGGRGGHEQGGGR
GGRGGYDHGGRGGGRGNKHQGGWTDGGSGGGGGYQDGGYRDSGFQPGGYHGGHSSGGYQG
GGYGGFQTSSSYTGSGYQGGGYQQDNRYQDGGHHGDRGGGRGGRGGRGGRGGRAGQGGGW
GGRGSQNYHQGGQFEQHFQHGGYQYNHSGFGQGRHYTS

    Click to Show/Hide
Family FAM98 family
Function
Positively stimulates PRMT1-induced protein arginine methylation. Involved in skeletal homeostasis. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts.

    Click to Show/Hide
HGNC ID
HGNC:24520
KEGG ID hsa:25940
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
FAM98A can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Cystine/glutamate transporter (SLC7A11) [Driver; Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Responsed Drug Metformin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 RKO cells Colon carcinoma Homo sapiens CVCL_0504
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo cells Colon adenocarcinoma Homo sapiens CVCL_0399
Caco-2 cells Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 15 cells Colon adenocarcinoma Homo sapiens CVCL_0292
DLD-1 cells Colon adenocarcinoma Homo sapiens CVCL_0248
FHC cells Normal Homo sapiens CVCL_3688
In Vivo Model
A total 1 x 106 SW620-vector or SW620-FAM98A cells were suspended in 100 ul PBS and injected s.c. into the back of 4- to 6-week-old male BALB/cnude mice (Laboratory Animal Unit, Southern Medical University, China). The sizes of the resulting tumors were measured weekly. Tumor volumes were calculated as follows: total tumor volume (mm3) = (Length x Width2)/2, where Length is the longest length. When the tumor sizes reached about 200 mm3, nude mice in the four groups were given PBS or 5-FU treatment (30 mg/kg, intraperitoneal injection, twice a week), respectively. Nude mice were maintained in a barrier facility in racks filtered with a high-efficiency particulate air filter.

    Click to Show/Hide
Response regulation The expressions of FAM98A and SLC7A11 were also downregulated after metformin treatment. And FAM98A is predominantly expressed in the colorectal cancer tissues and high FAM98A expression is usually accompanied by the high expression of SLC7A11, which usually means ferroptosis resistance.
Colorectal cancer [ICD-11: 2B91]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Protein FAM98A (FAM98A) Protein coding
 Regulator Info 
Responsed Drug Metformin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 RKO cells Colon carcinoma Homo sapiens CVCL_0504
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo cells Colon adenocarcinoma Homo sapiens CVCL_0399
Caco-2 cells Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 15 cells Colon adenocarcinoma Homo sapiens CVCL_0292
DLD-1 cells Colon adenocarcinoma Homo sapiens CVCL_0248
FHC cells Normal Homo sapiens CVCL_3688
In Vivo Model
A total 1 x 106 SW620-vector or SW620-FAM98A cells were suspended in 100 ul PBS and injected s.c. into the back of 4- to 6-week-old male BALB/cnude mice (Laboratory Animal Unit, Southern Medical University, China). The sizes of the resulting tumors were measured weekly. Tumor volumes were calculated as follows: total tumor volume (mm3) = (Length x Width2)/2, where Length is the longest length. When the tumor sizes reached about 200 mm3, nude mice in the four groups were given PBS or 5-FU treatment (30 mg/kg, intraperitoneal injection, twice a week), respectively. Nude mice were maintained in a barrier facility in racks filtered with a high-efficiency particulate air filter.

    Click to Show/Hide
Response regulation The expressions of FAM98A and SLC7A11 were also downregulated after metformin treatment. And FAM98A is predominantly expressed in the colorectal cancer tissues and high FAM98A expression is usually accompanied by the high expression of SLC7A11, which usually means ferroptosis resistance.
Metformin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Cystine/glutamate transporter (SLC7A11) Driver; Suppressor
 Target Info 
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 RKO cells Colon carcinoma Homo sapiens CVCL_0504
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo cells Colon adenocarcinoma Homo sapiens CVCL_0399
Caco-2 cells Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 15 cells Colon adenocarcinoma Homo sapiens CVCL_0292
DLD-1 cells Colon adenocarcinoma Homo sapiens CVCL_0248
FHC cells Normal Homo sapiens CVCL_3688
In Vivo Model
A total 1 x 106 SW620-vector or SW620-FAM98A cells were suspended in 100 ul PBS and injected s.c. into the back of 4- to 6-week-old male BALB/cnude mice (Laboratory Animal Unit, Southern Medical University, China). The sizes of the resulting tumors were measured weekly. Tumor volumes were calculated as follows: total tumor volume (mm3) = (Length x Width2)/2, where Length is the longest length. When the tumor sizes reached about 200 mm3, nude mice in the four groups were given PBS or 5-FU treatment (30 mg/kg, intraperitoneal injection, twice a week), respectively. Nude mice were maintained in a barrier facility in racks filtered with a high-efficiency particulate air filter.

    Click to Show/Hide
Response regulation The expressions of FAM98A and SLC7A11 were also downregulated after metformin treatment. And FAM98A is predominantly expressed in the colorectal cancer tissues and high FAM98A expression is usually accompanied by the high expression of SLC7A11, which usually means ferroptosis resistance.
References
Ref 1 FAM98A promotes resistance to 5-fluorouracil in colorectal cancer by suppressing ferroptosis. Arch Biochem Biophys. 2022 Jun 15;722:109216. doi: 10.1016/j.abb.2022.109216. Epub 2022 Apr 11.