Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10273)
Regulator Name Membrane-spanning 4-domains subfamily A member 15 (MS4A15)
Gene Name MS4A15
Gene ID 219995
Regulator Type Protein coding
Uniprot ID Q8N5U1
Sequence
MSAAPASNGVFVVIPPNNASGLCPPPAILPTSMCQPPGIMQFEEPPLGAQTPRATQPPDL
RPVETFLTGEPKVLGTVQILIGLIHLGFGSVLLMVRRGHVGIFFIEGGVPFWGGACFIIS
GSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFT
VLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVV

    Click to Show/Hide
Family MS4A family
Function
May be involved in signal transduction as a component of a multimeric receptor complex.

    Click to Show/Hide
HGNC ID
HGNC:28573
KEGG ID hsa:219995
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
MS4A15 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Stearoyl-CoA desaturase (SCD) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Fibrosarcoma ICD-11: 2B53
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell migration
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Calu-1 cells Lung squamous cell carcinoma Homo sapiens CVCL_0608
MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HEK-293T cells Normal Homo sapiens CVCL_0063
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
HeLa cells Endocervical adenocarcinoma Homo sapiens CVCL_0030
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Response regulation MS4A15 regulation of anti-ferroptotic lipid reservoirs provides a key resistance mechanism that is distinct from antioxidant and lipid detoxification pathways. And Scd1 and Fads2 are counterregulated with Ms4a15 OE in Fibrosarcoma.
Fibrosarcoma [ICD-11: 2B53]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Membrane-spanning 4-domains subfamily A member 15 (MS4A15) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell migration
In Vitro Model
 HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
Calu-1 cells Lung squamous cell carcinoma Homo sapiens CVCL_0608
MCF-7 cells Breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
HEK-293T cells Normal Homo sapiens CVCL_0063
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
HeLa cells Endocervical adenocarcinoma Homo sapiens CVCL_0030
A-549 cells Lung adenocarcinoma Homo sapiens CVCL_0023
Response regulation MS4A15 regulation of anti-ferroptotic lipid reservoirs provides a key resistance mechanism that is distinct from antioxidant and lipid detoxification pathways. And Scd1 and Fads2 are counterregulated with Ms4a15 OE in Fibrosarcoma.
References
Ref 1 MS4A15 drives ferroptosis resistance through calcium-restricted lipid remodeling. Cell Death Differ. 2022 Mar;29(3):670-686. doi: 10.1038/s41418-021-00883-z. Epub 2021 Oct 18.