Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10272)
Regulator Name Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3)
Synonyms
MESH1; HD domain-containing protein 3; Metazoan SpoT homolog 1; Penta-phosphate guanosine-3'-pyrophosphohydrolase
    Click to Show/Hide
Gene Name HDDC3
Gene ID 374659
Regulator Type Protein coding
Uniprot ID Q8N4P3
Sequence
MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKL
ADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI

    Click to Show/Hide
Family MESH1 family
Function
ppGpp hydrolyzing enzyme involved in starvation response.

    Click to Show/Hide
HGNC ID
HGNC:30522
KEGG ID hsa:374659
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
HDDC3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Browse Drug
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
HEK-293T cells Normal Homo sapiens CVCL_0063
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A673 cells Rhabdomyosarcoma Homo sapiens CVCL_0080
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation Ferroptosis-inducing erastin or cystine deprivation elevates MESH1 (HDDC3), whose overexpression depletes NADPH and sensitizes clear cell renal cell carcinoma cells to ferroptosis, whereas MESH1 depletion promotes ferroptosis survival by sustaining the levels of NADPH and GSH and by reducing lipid peroxidation.
Hereditary Leiomyomatosis [ICD-11: 2C90]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3) Protein coding
 Regulator Info 
Responsed Drug Erastin Investigative
 Drug Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
HEK-293T cells Normal Homo sapiens CVCL_0063
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A673 cells Rhabdomyosarcoma Homo sapiens CVCL_0080
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation Ferroptosis-inducing erastin or cystine deprivation elevates MESH1 (HDDC3), whose overexpression depletes NADPH and sensitizes clear cell renal cell carcinoma cells to ferroptosis, whereas MESH1 depletion promotes ferroptosis survival by sustaining the levels of NADPH and GSH and by reducing lipid peroxidation.
Erastin [Investigative]
 Drug Info 
In total 1 item(s) under this drug
Experiment 1 Reporting the Ferroptosis-centered Drug Response [1]
Drug for Ferroptosis Inducer
Response Target Unspecific Target
Responsed Disease Hereditary Leiomyomatosis ICD-11: 2C90
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 RCC4 cells Clear cell renal cell carcinoma Homo sapiens CVCL_0498
HEK-293T cells Normal Homo sapiens CVCL_0063
NCI-H1975 cells Lung adenocarcinoma Homo sapiens CVCL_1511
MDA-MB-231 cells Breast adenocarcinoma Homo sapiens CVCL_0062
786-O cells Renal cell carcinoma Homo sapiens CVCL_1051
PC-3 cells Prostate carcinoma Homo sapiens CVCL_0035
HT-1080 cells Fibrosarcoma Homo sapiens CVCL_0317
A673 cells Rhabdomyosarcoma Homo sapiens CVCL_0080
PANC-1 cells Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response regulation Ferroptosis-inducing erastin or cystine deprivation elevates MESH1 (HDDC3), whose overexpression depletes NADPH and sensitizes clear cell renal cell carcinoma cells to ferroptosis, whereas MESH1 depletion promotes ferroptosis survival by sustaining the levels of NADPH and GSH and by reducing lipid peroxidation.
References
Ref 1 MESH1 is a cytosolic NADPH phosphatase that regulates ferroptosis. Nat Metab. 2020 Mar;2(3):270-277. doi: 10.1038/s42255-020-0181-1. Epub 2020 Mar 9.