Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10261)
Regulator Name All trans-polyprenyl-diphosphate synthase PDSS2 (PDSS2)
Synonyms
C6orf210, DLP1; All-trans-decaprenyl-diphosphate synthase subunit 2; Candidate tumor suppressor protein; Decaprenyl pyrophosphate synthase subunit 2; Decaprenyl-diphosphate synthase subunit 2
    Click to Show/Hide
Gene Name PDSS2
Gene ID 57107
Regulator Type Protein coding
Uniprot ID Q86YH6
Sequence
MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIV
GYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLIS
KAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITD
DIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF
IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTS
AIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

    Click to Show/Hide
Family FPP/GGPP synthase family
Function
Heterotetrameric enzyme that catalyzes the condensation of farnesyl diphosphate (FPP), which acts as a primer, and isopentenyl diphosphate (IPP) to produce prenyl diphosphates of varying chain lengths and participates in the determination of the side chain of ubiquinone. Supplies nona and decaprenyl diphosphate, the precursors for the side chain of the isoprenoid quinones ubiquinone-9 (Q9) and ubiquinone-10 (Q10) respectively. The enzyme adds isopentenyl diphosphate molecules sequentially to farnesyl diphosphate with trans stereochemistry. May play a role during cerebellar development. May regulate mitochondrial respiratory chain function.

    Click to Show/Hide
HGNC ID
HGNC:23041
KEGG ID hsa:57107
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PDSS2 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Atherosclerosis ICD-11: BD40
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 hCAECs (Human coronary artery endothelial cells)
In Vivo Model
Eight-week-old male mice PDSS2 wild type [WT (n = 6)], PDSS2/, Nrf2/, Nrf2+/+, on C57BL/6 background (18-22 g) were provided by Nanjing Medical University (Nanjing, China). PDSS2/ mice (n = 12) were crossed with PDSS2/ to obtain PDSS2/, Nrf2/ (n = 6) and PDSS2/, Nrf2+/+ (n = 6) mice. Mice were fed an AIN76A Western diet for 8 weeks to accelerate the development of AS. Mice from each group were euthanized after 8 weeks.

    Click to Show/Hide
Response regulation Overexpression of PDSS2 suppressed the ferroptosis of HCAECs by promoting the activation of Nrf2 pathways. Thence PDSS2 may play a cardio-protective role in atherosclerosis (AS).
Atherosclerosis [ICD-11: BD40]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator All trans-polyprenyl-diphosphate synthase PDSS2 (PDSS2) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 hCAECs (Human coronary artery endothelial cells)
In Vivo Model
Eight-week-old male mice PDSS2 wild type [WT (n = 6)], PDSS2/, Nrf2/, Nrf2+/+, on C57BL/6 background (18-22 g) were provided by Nanjing Medical University (Nanjing, China). PDSS2/ mice (n = 12) were crossed with PDSS2/ to obtain PDSS2/, Nrf2/ (n = 6) and PDSS2/, Nrf2+/+ (n = 6) mice. Mice were fed an AIN76A Western diet for 8 weeks to accelerate the development of AS. Mice from each group were euthanized after 8 weeks.

    Click to Show/Hide
Response regulation Overexpression of PDSS2 suppressed the ferroptosis of HCAECs by promoting the activation of Nrf2 pathways. Thence PDSS2 may play a cardio-protective role in atherosclerosis (AS).
References
Ref 1 PDSS2 Inhibits the Ferroptosis of Vascular Endothelial Cells in Atherosclerosis by Activating Nrf2. J Cardiovasc Pharmacol. 2021 Apr 29;77(6):767-776. doi: 10.1097/FJC.0000000000001030.