Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10253)
Regulator Name Tripartite motif-containing protein 46 (TRIM46)
Synonyms
TRIFIC; Gene Y protein; Tripartite, fibronectin type-III and C-terminal SPRY motif protein
    Click to Show/Hide
Gene Name TRIM46
Gene ID 80128
Regulator Type Protein coding
Uniprot ID Q7Z4K8
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEEAVR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTVEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDSRWG
ASRERLAISKDQRAVRSVPGLPLLLAADRLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
ILLGSGASSNAGLTGRDGPTAGCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD

    Click to Show/Hide
Family TRIM/RBCC family
Function
Microtubule-associated protein that is involved in the formation of parallel microtubule bundles linked by cross-bridges in the proximal axon. Required for the uniform orientation and maintenance of the parallel microtubule fascicles, which are important for efficient cargo delivery and trafficking in axons. Thereby also required for proper axon specification, the establishment of neuronal polarity and proper neuronal migration.

    Click to Show/Hide
HGNC ID
HGNC:19019
KEGG ID hsa:80128
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TRIM46 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Retinopathy ICD-11: 9B71
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HRCECs (Human retinal capillary endothelial cells)
Response regulation TRIM46 interacted with GPX4, an important enzyme that suppresses ferroptosis, and promoted GPX4 ubiquitination. The role of TRIM46 in GPX4 ubiquitination should inspire the future development of new therapies against diabetic retinopathy (DR).
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Retinopathy ICD-11: 9B71
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
NF-kappa B signaling pathway hsa04064
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HRCECs (Human retinal capillary endothelial cells)
Response regulation Diabetic retinopathy (DR) as a severe diabetic complication contributes to blindness. TRIM46 interacts with IB to activate the NF-B signaling pathway, thereby enhancing cell proliferation inhibition, hyper permeability and the inflammatory response of HRCECs in a HG state.
Retinopathy [ICD-11: 9B71]
 Disease Info 
In total 2 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Tripartite motif-containing protein 46 (TRIM46) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HRCECs (Human retinal capillary endothelial cells)
Response regulation TRIM46 interacted with GPX4, an important enzyme that suppresses ferroptosis, and promoted GPX4 ubiquitination. The role of TRIM46 in GPX4 ubiquitination should inspire the future development of new therapies against diabetic retinopathy (DR).
Experiment 2 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Tripartite motif-containing protein 46 (TRIM46) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
NF-kappa B signaling pathway hsa04064
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HRCECs (Human retinal capillary endothelial cells)
Response regulation Diabetic retinopathy (DR) as a severe diabetic complication contributes to blindness. TRIM46 interacts with IB to activate the NF-B signaling pathway, thereby enhancing cell proliferation inhibition, hyper permeability and the inflammatory response of HRCECs in a HG state.
References
Ref 1 TRIM46 contributes to high glucose-induced ferroptosis and cell growth inhibition in human retinal capillary endothelial cells by facilitating GPX4 ubiquitination. Exp Cell Res. 2021 Oct 15;407(2):112800. doi: 10.1016/j.yexcr.2021.112800. Epub 2021 Sep 4.
Ref 2 TRIM46 aggravated high glucose-induced hyper permeability and inflammatory response in human retinal capillary endothelial cells by promoting IB ubiquitination. Eye Vis (Lond). 2022 Sep 5;9(1):35. doi: 10.1186/s40662-022-00305-2.