Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10248)
Regulator Name Progestin and adipoQ receptor family member 3 (PAQR3)
Synonyms
Progestin and adipoQ receptor family member III; Raf kinase trapping to Golgi
    Click to Show/Hide
Gene Name PAQR3
Gene ID 152559
Regulator Type Protein coding
Uniprot ID Q6TCH7
Sequence
MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPGSLKDNPYITDGYRAYLPSRLCI
KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCML
CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA
MILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAPRV
IVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQYRH
SKPCPDYVSHL

    Click to Show/Hide
Family ADIPOR family
Function
Functions as a spatial regulator of RAF1 kinase by sequestrating it to the Golgi.

    Click to Show/Hide
HGNC ID
HGNC:30130
KEGG ID hsa:152559
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
PAQR3 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Myeloid leukaemia ICD-11: 2B33
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MOLT-3 cells T-lymphoblastic leukemia Homo sapiens CVCL_0624
MOLT4 cells Adult T acute lymphoblastic leukemia Homo sapiens CVCL_0013
CEM/C1 cells T acute lymphoblastic leukemia Homo sapiens CVCL_3496
Jurkat cells T acute lymphoblastic leukemia Homo sapiens CVCL_0065
Response regulation PAQR3 inhibited proliferation and aggravated ferroptosis in acute lymphoblastic leukemia through modulation Nrf2 stability. This study suggested that PAQR3 may serve as an effective biological marker for ALL treatment.
Myeloid leukaemia [ICD-11: 2B33]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Progestin and adipoQ receptor family member 3 (PAQR3) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Ubiquitin mediated proteolysis hsa04120
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 MOLT-3 cells T-lymphoblastic leukemia Homo sapiens CVCL_0624
MOLT4 cells Adult T acute lymphoblastic leukemia Homo sapiens CVCL_0013
CEM/C1 cells T acute lymphoblastic leukemia Homo sapiens CVCL_3496
Jurkat cells T acute lymphoblastic leukemia Homo sapiens CVCL_0065
Response regulation PAQR3 inhibited proliferation and aggravated ferroptosis in acute lymphoblastic leukemia through modulation Nrf2 stability. This study suggested that PAQR3 may serve as an effective biological marker for ALL treatment.
References
Ref 1 PAQR3 inhibits proliferation and aggravates ferroptosis in acute lymphoblastic leukemia through modulation Nrf2 stability. Immun Inflamm Dis. 2021 Sep;9(3):827-839. doi: 10.1002/iid3.437. Epub 2021 May 6.