Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10243)
Regulator Name Torsin-2A (TOR2A)
Synonyms
TORP1; Torsin family 2 member A; Torsin-related protein 1
    Click to Show/Hide
Gene Name TOR2A
Gene ID 27433
Regulator Type Protein coding
Uniprot ID Q5JU69
Sequence
MAAATRGCRPWGSLLGLLGLVSAAAAAWDLASLRCTLGAFCECDFRPDLPGLECDLAQHL
AGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKSYVSSLLAHYLFQGGLRSPRV
HHFSPVLHFPHPSHIERYKKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGS
SWVVYGTNYRKAIFIFISNTGGKQINQVALEAWRSRRDREEILLQELEPVISRAVLDNPH
HGFSNSGIMEERLLDAVVPFLPLQRHHVRHCVLNELAQLGLEPRDEVVQAVLDSTTFFPE
DEQLFSSNGCKTVASRIAFFL

    Click to Show/Hide
Family ClpA/ClpB family
HGNC ID
HGNC:11996
KEGG ID hsa:27433
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
TOR2A can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Nuclear factor erythroid 2-related factor 2 (NFE2L2) [Suppressor; Marker]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Marker/Suppressor
Responsed Disease Chronic kidney disease ICD-11: GB61
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
Response regulation Interaction of salusin- ( TOR2A) with ferroptosis formed a positive feedback, thereby contributing to HG-induced HK-2 cell injury and diabetic nephropathy. Mechanistically, salusin inactivated nuclear factor erythroidderived 2like 2 (Nrf2) signaling, thus contributing to HGinduced ferroptosisrelated changes in HK2 cells.
Chronic kidney disease [ICD-11: GB61]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Torsin-2A (TOR2A) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
Response regulation Interaction of salusin- ( TOR2A) with ferroptosis formed a positive feedback, thereby contributing to HG-induced HK-2 cell injury and diabetic nephropathy. Mechanistically, salusin inactivated nuclear factor erythroidderived 2like 2 (Nrf2) signaling, thus contributing to HGinduced ferroptosisrelated changes in HK2 cells.
References
Ref 1 Salusin participates in high glucoseinduced HK2 cell ferroptosis in a Nrf2dependent manner. Mol Med Rep. 2021 Sep;24(3):674. doi: 10.3892/mmr.2021.12313. Epub 2021 Jul 23.