Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10208)
Regulator Name Serine/arginine-rich splicing factor 9 (SRSF9)
Synonyms
SFRS9, SRP30C; Pre-mRNA-splicing factor SRp30C; Splicing factor, arginine/serine-rich 9
    Click to Show/Hide
Gene Name SRSF9
Gene ID 8683
Regulator Type Protein coding
Uniprot ID Q13242
Sequence
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

    Click to Show/Hide
Family Splicing factor SR family
Function
Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.

    Click to Show/Hide
HGNC ID
HGNC:10791
KEGG ID hsa:8683
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
SRSF9 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Caco-2 cells Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo cells Colon adenocarcinoma Homo sapiens CVCL_0399
DLD-1 cells Colon adenocarcinoma Homo sapiens CVCL_0248
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
In Vivo Model
LOVO cells were stably transfected with SRSF9-shRNA1 or NC-shRNA. Caco-2 cells were stably transfected with SRSF9-OE or empty vector. Then the transfected CRC cells (2*105 cells/100 uL) were injected into the right armpit of mouse 6-8-week-old male athymic nude mice. When the tumors reached 50 mm3 at day 7, erastin (40 mg/kg) was administrated to mice by intraperitoneal injection twice every other day.

    Click to Show/Hide
Response regulation SRSF9's regulation of GPX4 as an essential mechanism driving colorectal cancer (CRC) tumorigenesis and resistance of erastin-induced ferroptosis. This molecular mechanism may provide a novel method for improving the sensitivity of CRC to erastin.
Colorectal cancer [ICD-11: 2B91]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Serine/arginine-rich splicing factor 9 (SRSF9) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
In Vitro Model
 Caco-2 cells Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 116 cells Colon carcinoma Homo sapiens CVCL_0291
SW620 cells Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo cells Colon adenocarcinoma Homo sapiens CVCL_0399
DLD-1 cells Colon adenocarcinoma Homo sapiens CVCL_0248
SW480 cells Colon adenocarcinoma Homo sapiens CVCL_0546
In Vivo Model
LOVO cells were stably transfected with SRSF9-shRNA1 or NC-shRNA. Caco-2 cells were stably transfected with SRSF9-OE or empty vector. Then the transfected CRC cells (2*105 cells/100 uL) were injected into the right armpit of mouse 6-8-week-old male athymic nude mice. When the tumors reached 50 mm3 at day 7, erastin (40 mg/kg) was administrated to mice by intraperitoneal injection twice every other day.

    Click to Show/Hide
Response regulation SRSF9's regulation of GPX4 as an essential mechanism driving colorectal cancer (CRC) tumorigenesis and resistance of erastin-induced ferroptosis. This molecular mechanism may provide a novel method for improving the sensitivity of CRC to erastin.
References
Ref 1 Inhibition of SRSF9 enhances the sensitivity of colorectal cancer to erastin-induced ferroptosis by reducing glutathione peroxidase 4 expression. Int J Biochem Cell Biol. 2021 May;134:105948. doi: 10.1016/j.biocel.2021.105948. Epub 2021 Feb 17.