Ferroptosis Regulator Information

General Information of the Ferroptosis Regulator (ID: REG10196)
Regulator Name Caveolin-1 (CAV1)
Synonyms
CAV
    Click to Show/Hide
Gene Name CAV1
Gene ID 857
Regulator Type Protein coding
Uniprot ID Q03135
Sequence
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

    Click to Show/Hide
Family Caveolin family
Function
May act as a scaffolding protein within caveolar membranes. Forms a stable heterooligomeric complex with CAV2 that targets to lipid rafts and drives caveolae formation. Mediates the recruitment of CAVIN proteins (CAVIN1/2/3/4) to the caveolae. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. Negatively regulates TGFB1-mediated activation of SMAD2/3 by mediating the internalization of TGFBR1 from membrane rafts leading to its subsequent degradation.

    Click to Show/Hide
HGNC ID
HGNC:1527
KEGG ID hsa:857
Full List of the Ferroptosis Target of This Regulator and Corresponding Disease/Drug Response(s)
CAV1 can regulate the following target(s), and cause disease/drug response(s). You can browse detail information of target(s) or disease/drug response(s).
Browse Target
Browse Disease
Phospholipid hydroperoxide glutathione peroxidase (GPX4) [Suppressor]
 Target Info 
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [1]
Target for Ferroptosis Suppressor
Responsed Disease Head neck squamous cell carcinoma ICD-11: 2D60
 Disease Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 HN6 cells Tongue squamous cell carcinoma Homo sapiens CVCL_8129
HN30 cells Pharyngeal squamous cell carcinoma Homo sapiens CVCL_5525
CAL-27 cells Tongue adenosquamous carcinom Homo sapiens CVCL_1107
SCC-9 cells Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-25 cells Squamous carcinoma Homo sapiens CVCL_1682
Response regulation Overexpression of CAV1 in head and neck squamous cell carcinoma (HNSCC) inhibited the process of ferroptosis, leading to aggressive phenotypes, as well as worse prognosis. And the knockdown of CAV1 could reduce the expression of GPX4.
Unspecific Target [Unspecific Target]
In total 1 item(s) under this target
Experiment 1 Reporting the Ferroptosis Target of This Regulator [2]
Responsed Disease Kidney calculus ICD-11: GB70
 Disease Info 
Pathway Response Ferroptosis hsa04216
Autophagy hsa04140
Wnt signaling pathway hsa04310
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Six male SD rats (8 weeks old, 300 g) were purchased from the experimental Animal Centre of Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology. The two groups included control group and the glyoxylic acid group, rats in the glyoxylic acid group were intraperitoneally injected with glyoxylic acid (10.5 mg/ml, 6.66 ml/kg, Macklin, Shanghai, China) every day for 9 days. All rats were given free access to food and maintained in an environment of 25 during the experimental period. 7% chloral hydrate (0.7 ml/100 g) was used for anaesthesia.

    Click to Show/Hide
Response regulation Calcium oxalate (CaOx) is the most common type of kidney stone. CAV1 could ameliorate autophagy-dependent ferroptosis through the LRP6/Wnt/-Catenin axis, and finally alleviate CaOx stone formation.
Head neck squamous cell carcinoma [ICD-11: 2D60]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [1]
Target Regulator Caveolin-1 (CAV1) Protein coding
 Regulator Info 
Pathway Response Fatty acid metabolism hsa01212
Ferroptosis hsa04216
Cell Process Cell ferroptosis
Cell proliferation
Cell migration
Cell invasion
In Vitro Model
 HN6 cells Tongue squamous cell carcinoma Homo sapiens CVCL_8129
HN30 cells Pharyngeal squamous cell carcinoma Homo sapiens CVCL_5525
CAL-27 cells Tongue adenosquamous carcinom Homo sapiens CVCL_1107
SCC-9 cells Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-25 cells Squamous carcinoma Homo sapiens CVCL_1682
Response regulation Overexpression of CAV1 in head and neck squamous cell carcinoma (HNSCC) inhibited the process of ferroptosis, leading to aggressive phenotypes, as well as worse prognosis. And the knockdown of CAV1 could reduce the expression of GPX4.
Kidney calculus [ICD-11: GB70]
 Disease Info 
In total 1 item(s) under this disease
Experiment 1 Reporting the Ferroptosis-centered Disease Response [2]
Target Regulator Caveolin-1 (CAV1) Protein coding
 Regulator Info 
Pathway Response Ferroptosis hsa04216
Autophagy hsa04140
Wnt signaling pathway hsa04310
Cell Process Cell ferroptosis
Cell autophagy
In Vitro Model
 HK-2 cells Normal Homo sapiens CVCL_0302
In Vivo Model
Six male SD rats (8 weeks old, 300 g) were purchased from the experimental Animal Centre of Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology. The two groups included control group and the glyoxylic acid group, rats in the glyoxylic acid group were intraperitoneally injected with glyoxylic acid (10.5 mg/ml, 6.66 ml/kg, Macklin, Shanghai, China) every day for 9 days. All rats were given free access to food and maintained in an environment of 25 during the experimental period. 7% chloral hydrate (0.7 ml/100 g) was used for anaesthesia.

    Click to Show/Hide
Response regulation Calcium oxalate (CaOx) is the most common type of kidney stone. CAV1 could ameliorate autophagy-dependent ferroptosis through the LRP6/Wnt/-Catenin axis, and finally alleviate CaOx stone formation.
References
Ref 1 Caveolin-1 promotes cancer progression via inhibiting ferroptosis in head and neck squamous cell carcinoma. J Oral Pathol Med. 2022 Jan;51(1):52-62. doi: 10.1111/jop.13267. Epub 2021 Dec 19.
Ref 2 CAV1 alleviated CaOx stones formation via suppressing autophagy-dependent ferroptosis. PeerJ. 2022 Sep 15;10:e14033. doi: 10.7717/peerj.14033. eCollection 2022.